Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB331_RS05905 | Genome accession | NZ_CP167124 |
| Coordinates | 1168926..1169108 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 13 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1168926..1203936 | 1168926..1169108 | within | 0 |
Gene organization within MGE regions
Location: 1168926..1203936
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB331_RS05905 (ACB331_05910) | prx | 1168926..1169108 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| ACB331_RS05910 (ACB331_05915) | sda3 | 1169347..1170147 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| ACB331_RS05915 (ACB331_05920) | - | 1170418..1170852 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| ACB331_RS05920 (ACB331_05925) | - | 1170922..1172127 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| ACB331_RS05925 (ACB331_05930) | - | 1172243..1172470 (-) | 228 | WP_003058873.1 | phage holin | - |
| ACB331_RS05930 (ACB331_05935) | - | 1172467..1172742 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| ACB331_RS05935 (ACB331_05940) | - | 1172752..1173369 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| ACB331_RS05940 (ACB331_05945) | - | 1173366..1173803 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| ACB331_RS05945 (ACB331_05950) | - | 1173815..1175683 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| ACB331_RS05950 (ACB331_05955) | - | 1175680..1176375 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| ACB331_RS05955 (ACB331_05960) | - | 1176372..1178729 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| ACB331_RS05960 (ACB331_05965) | - | 1178729..1179100 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| ACB331_RS05965 (ACB331_05970) | - | 1179115..1179378 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| ACB331_RS05970 (ACB331_05975) | - | 1179389..1179982 (-) | 594 | WP_010922456.1 | tail protein | - |
| ACB331_RS05975 (ACB331_05980) | - | 1179994..1180329 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| ACB331_RS05980 (ACB331_05985) | - | 1180330..1180566 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| ACB331_RS05985 (ACB331_05990) | - | 1180559..1180897 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| ACB331_RS05990 (ACB331_05995) | - | 1180857..1181279 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ACB331_RS05995 (ACB331_06000) | - | 1181289..1181489 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| ACB331_RS06000 (ACB331_06005) | - | 1181489..1182400 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| ACB331_RS06005 (ACB331_06010) | - | 1182425..1182886 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| ACB331_RS06010 (ACB331_06015) | - | 1182967..1184382 (-) | 1416 | WP_011285619.1 | terminase | - |
| ACB331_RS06015 (ACB331_06020) | - | 1184492..1184758 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| ACB331_RS06020 (ACB331_06025) | - | 1184751..1184930 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| ACB331_RS06025 (ACB331_06030) | - | 1184980..1185204 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| ACB331_RS06030 (ACB331_06035) | - | 1185210..1186703 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| ACB331_RS06035 (ACB331_06040) | - | 1186696..1187964 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| ACB331_RS06040 (ACB331_06045) | - | 1187961..1188317 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| ACB331_RS06045 (ACB331_06050) | - | 1188466..1188810 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| ACB331_RS06050 (ACB331_06055) | - | 1188919..1189338 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| ACB331_RS06055 (ACB331_06060) | - | 1189606..1190241 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| ACB331_RS06060 (ACB331_06065) | - | 1190243..1190512 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| ACB331_RS06065 (ACB331_06070) | - | 1190596..1191108 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| ACB331_RS06070 (ACB331_06075) | - | 1191105..1191446 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| ACB331_RS06075 (ACB331_06080) | - | 1191624..1191791 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| ACB331_RS06080 (ACB331_06085) | - | 1191801..1192598 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACB331_RS06085 (ACB331_06090) | - | 1192595..1193524 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| ACB331_RS06090 (ACB331_06095) | - | 1193527..1193856 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| ACB331_RS06095 (ACB331_06100) | - | 1193912..1194118 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| ACB331_RS06100 (ACB331_06105) | - | 1194127..1194267 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| ACB331_RS06105 (ACB331_06110) | - | 1194264..1194497 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| ACB331_RS06110 (ACB331_06115) | - | 1194478..1194867 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| ACB331_RS06115 (ACB331_06120) | - | 1195012..1195251 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| ACB331_RS06120 (ACB331_06125) | - | 1195351..1195536 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| ACB331_RS06125 (ACB331_06130) | - | 1195538..1195849 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| ACB331_RS06130 (ACB331_06135) | - | 1195927..1196112 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| ACB331_RS06135 (ACB331_06140) | - | 1196279..1196518 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| ACB331_RS06140 (ACB331_06145) | - | 1196660..1197466 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| ACB331_RS06145 (ACB331_06150) | - | 1197401..1197667 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| ACB331_RS06150 (ACB331_06155) | - | 1197699..1198415 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| ACB331_RS06155 (ACB331_06160) | - | 1198427..1198618 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| ACB331_RS06160 (ACB331_06165) | - | 1199254..1199349 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| ACB331_RS06165 (ACB331_06170) | - | 1199772..1200119 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| ACB331_RS06170 (ACB331_06175) | - | 1200123..1200503 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB331_RS06175 (ACB331_06180) | - | 1200515..1200781 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| ACB331_RS06180 (ACB331_06185) | - | 1200905..1202047 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ACB331_RS06185 (ACB331_06190) | - | 1202137..1202412 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ACB331_RS06190 (ACB331_06195) | - | 1202511..1203098 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| ACB331_RS06195 (ACB331_06200) | - | 1203076..1203918 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1038447 ACB331_RS05905 WP_011017964.1 1168926..1169108(-) (prx) [Streptococcus pyogenes strain Isolate 13]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1038447 ACB331_RS05905 WP_011017964.1 1168926..1169108(-) (prx) [Streptococcus pyogenes strain Isolate 13]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |