Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB328_RS05060 | Genome accession | NZ_CP167123 |
| Coordinates | 1007185..1007373 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 32 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999601..1045911 | 1007185..1007373 | within | 0 |
Gene organization within MGE regions
Location: 999601..1045911
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB328_RS05025 (ACB328_05030) | pfkA | 999601..1000614 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| ACB328_RS05030 (ACB328_05035) | - | 1000694..1003804 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| ACB328_RS05035 (ACB328_05040) | - | 1003989..1004360 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| ACB328_RS05040 (ACB328_05045) | - | 1004360..1005058 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ACB328_RS05045 (ACB328_05050) | - | 1005068..1005853 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| ACB328_RS05050 (ACB328_05055) | - | 1005980..1006594 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| ACB328_RS05060 (ACB328_05065) | prx | 1007185..1007373 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| ACB328_RS05065 (ACB328_05070) | speA | 1007593..1008348 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| ACB328_RS05070 (ACB328_05075) | - | 1008470..1009129 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| ACB328_RS05075 (ACB328_05080) | - | 1009129..1009350 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| ACB328_RS05080 (ACB328_05085) | - | 1009360..1010133 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| ACB328_RS05085 (ACB328_05090) | - | 1010144..1010746 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| ACB328_RS05090 (ACB328_05095) | - | 1010758..1011522 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| ACB328_RS05095 (ACB328_05100) | - | 1011524..1011856 (-) | 333 | WP_011285562.1 | phage holin | - |
| ACB328_RS05100 (ACB328_05105) | - | 1011856..1012179 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| ACB328_RS05105 (ACB328_05110) | - | 1012193..1012315 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| ACB328_RS05110 (ACB328_05115) | - | 1012329..1012676 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| ACB328_RS05115 (ACB328_05120) | - | 1012687..1014549 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| ACB328_RS05120 (ACB328_05125) | - | 1014554..1017994 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| ACB328_RS05125 (ACB328_05130) | - | 1017995..1019479 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| ACB328_RS05130 (ACB328_05135) | - | 1019480..1021285 (-) | 1806 | WP_011054802.1 | tail protein | - |
| ACB328_RS05135 (ACB328_05140) | - | 1021278..1021736 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| ACB328_RS05140 (ACB328_05145) | - | 1021709..1022026 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| ACB328_RS05145 (ACB328_05150) | - | 1022039..1022545 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| ACB328_RS05150 (ACB328_05155) | - | 1022557..1022967 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| ACB328_RS05155 (ACB328_05160) | - | 1022969..1023364 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| ACB328_RS05160 (ACB328_05165) | - | 1023361..1023672 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| ACB328_RS05165 (ACB328_05170) | - | 1023669..1024013 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| ACB328_RS05170 (ACB328_05175) | - | 1024027..1024320 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| ACB328_RS05175 (ACB328_05180) | - | 1024333..1025223 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| ACB328_RS05180 (ACB328_05185) | - | 1025242..1025811 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| ACB328_RS05185 (ACB328_05190) | - | 1025920..1026054 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| ACB328_RS05190 (ACB328_05195) | - | 1026056..1026325 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| ACB328_RS05195 (ACB328_05200) | - | 1026332..1027240 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| ACB328_RS05200 (ACB328_05205) | - | 1027209..1028534 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| ACB328_RS05205 (ACB328_05210) | - | 1028534..1029808 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| ACB328_RS05210 (ACB328_05215) | - | 1029798..1030178 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| ACB328_RS05215 (ACB328_05220) | - | 1030788..1031222 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB328_RS05220 (ACB328_05225) | - | 1031508..1031774 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| ACB328_RS05225 (ACB328_05230) | - | 1031771..1032295 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| ACB328_RS05230 (ACB328_05235) | - | 1032298..1032930 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ACB328_RS05235 (ACB328_05240) | - | 1032932..1033216 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| ACB328_RS05240 (ACB328_05245) | - | 1033213..1033383 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| ACB328_RS05245 (ACB328_05250) | - | 1033380..1033616 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| ACB328_RS05250 (ACB328_05255) | - | 1033616..1033861 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| ACB328_RS05255 (ACB328_05260) | - | 1033858..1034214 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| ACB328_RS05260 (ACB328_05265) | - | 1034211..1034651 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACB328_RS05265 (ACB328_05270) | - | 1034651..1034854 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| ACB328_RS05270 (ACB328_05275) | ssb | 1034860..1035285 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| ACB328_RS05275 (ACB328_05280) | - | 1035278..1035952 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| ACB328_RS05280 (ACB328_05285) | - | 1035953..1036435 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| ACB328_RS05285 (ACB328_05290) | - | 1036457..1036711 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| ACB328_RS05290 (ACB328_05295) | - | 1036692..1037045 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| ACB328_RS05295 (ACB328_05300) | - | 1037186..1037968 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| ACB328_RS05300 (ACB328_05305) | - | 1037955..1038785 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACB328_RS05305 (ACB328_05310) | - | 1038799..1038987 (-) | 189 | Protein_996 | XRE family transcriptional regulator | - |
| ACB328_RS05310 (ACB328_05315) | - | 1039221..1039460 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| ACB328_RS05315 (ACB328_05320) | - | 1039591..1039800 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| ACB328_RS05320 (ACB328_05325) | - | 1039910..1040110 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| ACB328_RS05325 (ACB328_05330) | - | 1040184..1040570 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| ACB328_RS05330 (ACB328_05335) | - | 1040559..1040768 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| ACB328_RS05335 (ACB328_05340) | - | 1040822..1041421 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| ACB328_RS05340 (ACB328_05345) | - | 1041451..1041609 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| ACB328_RS05345 (ACB328_05350) | - | 1041966..1042790 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| ACB328_RS05350 (ACB328_05355) | - | 1042826..1043719 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| ACB328_RS05355 (ACB328_05360) | - | 1043840..1044928 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| ACB328_RS05360 (ACB328_05365) | - | 1045291..1045911 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=1038387 ACB328_RS05060 WP_011285559.1 1007185..1007373(-) (prx) [Streptococcus pyogenes strain Isolate 32]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1038387 ACB328_RS05060 WP_011285559.1 1007185..1007373(-) (prx) [Streptococcus pyogenes strain Isolate 32]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |