Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | V2K10_RS06970 | Genome accession | NZ_CP167067 |
| Coordinates | 1381055..1381234 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain Isolate 21 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1381055..1421672 | 1381055..1381234 | within | 0 |
Gene organization within MGE regions
Location: 1381055..1421672
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V2K10_RS06970 (V2K10_006970) | prx | 1381055..1381234 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| V2K10_RS06975 (V2K10_006975) | sda1 | 1381473..1382645 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| V2K10_RS06980 (V2K10_006980) | - | 1382761..1383957 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| V2K10_RS06985 (V2K10_006985) | - | 1384068..1384253 (-) | 186 | WP_002988802.1 | holin | - |
| V2K10_RS06990 (V2K10_006990) | - | 1384250..1384549 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| V2K10_RS06995 (V2K10_006995) | - | 1384560..1385180 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| V2K10_RS07000 (V2K10_007000) | - | 1385183..1385344 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| V2K10_RS07005 (V2K10_007005) | - | 1385353..1387260 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| V2K10_RS07010 (V2K10_007010) | - | 1387271..1387906 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| V2K10_RS07015 (V2K10_007015) | - | 1387906..1388961 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| V2K10_RS07020 (V2K10_007020) | - | 1388958..1390940 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| V2K10_RS07025 (V2K10_007025) | - | 1390950..1391792 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| V2K10_RS07030 (V2K10_007030) | - | 1391804..1396186 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| V2K10_RS07035 (V2K10_007035) | - | 1396201..1396434 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| V2K10_RS07040 (V2K10_007040) | - | 1396509..1396964 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| V2K10_RS07045 (V2K10_007045) | - | 1397018..1397617 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| V2K10_RS07050 (V2K10_007050) | - | 1397629..1397988 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| V2K10_RS07055 (V2K10_007055) | - | 1397992..1398336 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| V2K10_RS07060 (V2K10_007060) | - | 1398333..1398611 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| V2K10_RS07065 (V2K10_007065) | - | 1398622..1398978 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| V2K10_RS07070 (V2K10_007070) | - | 1398990..1399877 (-) | 888 | Protein_1338 | phage capsid protein | - |
| V2K10_RS07075 (V2K10_007075) | - | 1399890..1400459 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| V2K10_RS07080 (V2K10_007080) | - | 1400615..1400881 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| V2K10_RS07085 (V2K10_007085) | - | 1400884..1401072 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| V2K10_RS07090 (V2K10_007090) | - | 1401103..1402548 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| V2K10_RS07095 (V2K10_007095) | - | 1402508..1404040 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| V2K10_RS07100 (V2K10_007100) | - | 1404056..1405333 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| V2K10_RS07105 (V2K10_007105) | - | 1405323..1405775 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| V2K10_RS07110 (V2K10_007110) | - | 1405865..1406281 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| V2K10_RS07115 (V2K10_007115) | - | 1406278..1406469 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| V2K10_RS07120 (V2K10_007120) | - | 1406459..1407310 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| V2K10_RS07125 (V2K10_007125) | - | 1407319..1407585 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| V2K10_RS07130 (V2K10_007130) | - | 1407582..1407749 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| V2K10_RS07135 (V2K10_007135) | - | 1407750..1409072 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| V2K10_RS07140 (V2K10_007140) | - | 1409069..1409344 (-) | 276 | WP_032461521.1 | VRR-NUC domain-containing protein | - |
| V2K10_RS07145 (V2K10_007145) | - | 1409731..1412115 (-) | 2385 | WP_330818627.1 | phage/plasmid primase, P4 family | - |
| V2K10_RS07150 (V2K10_007150) | - | 1412120..1414042 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| V2K10_RS07155 (V2K10_007155) | - | 1414085..1414642 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| V2K10_RS07160 (V2K10_007160) | - | 1414653..1415051 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| V2K10_RS07165 (V2K10_007165) | - | 1415055..1416209 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| V2K10_RS07170 (V2K10_007170) | - | 1416209..1416508 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| V2K10_RS07175 (V2K10_007175) | - | 1416596..1416799 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| V2K10_RS07180 (V2K10_007180) | - | 1416945..1417331 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| V2K10_RS07185 (V2K10_007185) | - | 1417328..1417531 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| V2K10_RS07190 (V2K10_007190) | - | 1417524..1417694 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| V2K10_RS07195 (V2K10_007195) | - | 1417691..1417966 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| V2K10_RS07200 (V2K10_007200) | - | 1418028..1418243 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| V2K10_RS07205 (V2K10_007205) | - | 1418291..1418704 (+) | 414 | WP_032461522.1 | hypothetical protein | - |
| V2K10_RS07210 (V2K10_007210) | - | 1418689..1418841 (-) | 153 | WP_011527730.1 | hypothetical protein | - |
| V2K10_RS07215 (V2K10_007215) | - | 1419116..1419517 (+) | 402 | WP_011285676.1 | helix-turn-helix domain-containing protein | - |
| V2K10_RS07220 (V2K10_007220) | - | 1419531..1419914 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| V2K10_RS07225 (V2K10_007225) | - | 1419925..1420476 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| V2K10_RS07230 (V2K10_007230) | - | 1420593..1421672 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=1038201 V2K10_RS06970 WP_002988813.1 1381055..1381234(-) (prx) [Streptococcus pyogenes strain Isolate 21]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1038201 V2K10_RS06970 WP_002988813.1 1381055..1381234(-) (prx) [Streptococcus pyogenes strain Isolate 21]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |