Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB338_RS07175 | Genome accession | NZ_CP167024 |
| Coordinates | 1408539..1408718 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain Isolate | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408539..1449155 | 1408539..1408718 | within | 0 |
Gene organization within MGE regions
Location: 1408539..1449155
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB338_RS07175 (ACB338_07180) | prx | 1408539..1408718 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ACB338_RS07180 (ACB338_07185) | sda1 | 1408957..1410129 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ACB338_RS07185 (ACB338_07190) | - | 1410245..1411441 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ACB338_RS07190 (ACB338_07195) | - | 1411552..1411737 (-) | 186 | WP_002988802.1 | holin | - |
| ACB338_RS07195 (ACB338_07200) | - | 1411734..1412033 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ACB338_RS07200 (ACB338_07205) | - | 1412044..1412664 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ACB338_RS07205 (ACB338_07210) | - | 1412667..1412828 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ACB338_RS07210 (ACB338_07215) | - | 1412837..1414744 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| ACB338_RS07215 (ACB338_07220) | - | 1414755..1415390 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| ACB338_RS07220 (ACB338_07225) | - | 1415390..1416445 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ACB338_RS07225 (ACB338_07230) | - | 1416442..1418424 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ACB338_RS07230 (ACB338_07235) | - | 1418434..1419276 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ACB338_RS07235 (ACB338_07240) | - | 1419288..1423670 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ACB338_RS07240 (ACB338_07245) | - | 1423685..1423918 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ACB338_RS07245 (ACB338_07250) | - | 1423993..1424448 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ACB338_RS07250 (ACB338_07255) | - | 1424502..1425101 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ACB338_RS07255 (ACB338_07260) | - | 1425113..1425472 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| ACB338_RS07260 (ACB338_07265) | - | 1425476..1425820 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACB338_RS07265 (ACB338_07270) | - | 1425817..1426095 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ACB338_RS07270 (ACB338_07275) | - | 1426106..1426462 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ACB338_RS07275 (ACB338_07280) | - | 1426474..1427361 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| ACB338_RS07280 (ACB338_07285) | - | 1427374..1427943 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ACB338_RS07285 (ACB338_07290) | - | 1428099..1428365 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ACB338_RS07290 (ACB338_07295) | - | 1428368..1428556 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ACB338_RS07295 (ACB338_07300) | - | 1428587..1430032 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ACB338_RS07300 (ACB338_07305) | - | 1429992..1431524 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| ACB338_RS07305 (ACB338_07310) | - | 1431540..1432817 (-) | 1278 | WP_371488388.1 | PBSX family phage terminase large subunit | - |
| ACB338_RS07310 (ACB338_07315) | - | 1432807..1433259 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ACB338_RS07315 (ACB338_07320) | - | 1433349..1433765 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ACB338_RS07320 (ACB338_07325) | - | 1433762..1433953 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ACB338_RS07325 (ACB338_07330) | - | 1433943..1434794 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| ACB338_RS07330 (ACB338_07335) | - | 1434803..1435069 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ACB338_RS07335 (ACB338_07340) | - | 1435066..1435233 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ACB338_RS07340 (ACB338_07345) | - | 1435234..1436556 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ACB338_RS07345 (ACB338_07350) | - | 1436553..1436828 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ACB338_RS07350 (ACB338_07355) | - | 1437215..1439599 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| ACB338_RS07355 (ACB338_07360) | - | 1439604..1441526 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ACB338_RS07360 (ACB338_07365) | - | 1441569..1442126 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ACB338_RS07365 (ACB338_07370) | - | 1442137..1442535 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ACB338_RS07370 (ACB338_07375) | - | 1442539..1443693 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ACB338_RS07375 (ACB338_07380) | - | 1443693..1443992 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ACB338_RS07380 (ACB338_07385) | - | 1444080..1444283 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ACB338_RS07385 (ACB338_07390) | - | 1444429..1444815 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ACB338_RS07390 (ACB338_07395) | - | 1444812..1445015 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ACB338_RS07395 (ACB338_07400) | - | 1445008..1445178 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ACB338_RS07400 (ACB338_07405) | - | 1445175..1445450 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ACB338_RS07405 (ACB338_07410) | - | 1445512..1445727 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ACB338_RS07410 (ACB338_07415) | - | 1445775..1446188 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ACB338_RS07415 (ACB338_07420) | - | 1446169..1446324 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ACB338_RS07420 (ACB338_07425) | - | 1446650..1447000 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| ACB338_RS07425 (ACB338_07430) | - | 1447014..1447397 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB338_RS07430 (ACB338_07435) | - | 1447408..1447959 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ACB338_RS07435 (ACB338_07440) | - | 1448076..1449155 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=1038090 ACB338_RS07175 WP_002988813.1 1408539..1408718(-) (prx) [Streptococcus pyogenes strain Isolate]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1038090 ACB338_RS07175 WP_002988813.1 1408539..1408718(-) (prx) [Streptococcus pyogenes strain Isolate]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |