Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB338_RS05905 | Genome accession | NZ_CP167024 |
| Coordinates | 1168863..1169045 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1168863..1203873 | 1168863..1169045 | within | 0 |
Gene organization within MGE regions
Location: 1168863..1203873
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB338_RS05905 (ACB338_05910) | prx | 1168863..1169045 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| ACB338_RS05910 (ACB338_05915) | sda3 | 1169284..1170084 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| ACB338_RS05915 (ACB338_05920) | - | 1170355..1170789 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| ACB338_RS05920 (ACB338_05925) | - | 1170859..1172064 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| ACB338_RS05925 (ACB338_05930) | - | 1172180..1172407 (-) | 228 | WP_003058873.1 | phage holin | - |
| ACB338_RS05930 (ACB338_05935) | - | 1172404..1172679 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| ACB338_RS05935 (ACB338_05940) | - | 1172689..1173306 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| ACB338_RS05940 (ACB338_05945) | - | 1173303..1173740 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| ACB338_RS05945 (ACB338_05950) | - | 1173752..1175620 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| ACB338_RS05950 (ACB338_05955) | - | 1175617..1176312 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| ACB338_RS05955 (ACB338_05960) | - | 1176309..1178666 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| ACB338_RS05960 (ACB338_05965) | - | 1178666..1179037 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| ACB338_RS05965 (ACB338_05970) | - | 1179052..1179315 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| ACB338_RS05970 (ACB338_05975) | - | 1179326..1179919 (-) | 594 | WP_010922456.1 | tail protein | - |
| ACB338_RS05975 (ACB338_05980) | - | 1179931..1180266 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| ACB338_RS05980 (ACB338_05985) | - | 1180267..1180503 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| ACB338_RS05985 (ACB338_05990) | - | 1180496..1180834 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| ACB338_RS05990 (ACB338_05995) | - | 1180794..1181216 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ACB338_RS05995 (ACB338_06000) | - | 1181226..1181426 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| ACB338_RS06000 (ACB338_06005) | - | 1181426..1182337 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| ACB338_RS06005 (ACB338_06010) | - | 1182362..1182823 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| ACB338_RS06010 (ACB338_06015) | - | 1182904..1184319 (-) | 1416 | WP_011285619.1 | terminase | - |
| ACB338_RS06015 (ACB338_06020) | - | 1184429..1184695 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| ACB338_RS06020 (ACB338_06025) | - | 1184688..1184867 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| ACB338_RS06025 (ACB338_06030) | - | 1184917..1185141 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| ACB338_RS06030 (ACB338_06035) | - | 1185147..1186640 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| ACB338_RS06035 (ACB338_06040) | - | 1186633..1187901 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| ACB338_RS06040 (ACB338_06045) | - | 1187898..1188254 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| ACB338_RS06045 (ACB338_06050) | - | 1188403..1188747 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| ACB338_RS06050 (ACB338_06055) | - | 1188856..1189275 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| ACB338_RS06055 (ACB338_06060) | - | 1189543..1190178 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| ACB338_RS06060 (ACB338_06065) | - | 1190180..1190449 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| ACB338_RS06065 (ACB338_06070) | - | 1190533..1191045 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| ACB338_RS06070 (ACB338_06075) | - | 1191042..1191383 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| ACB338_RS06075 (ACB338_06080) | - | 1191561..1191728 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| ACB338_RS06080 (ACB338_06085) | - | 1191738..1192535 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACB338_RS06085 (ACB338_06090) | - | 1192532..1193461 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| ACB338_RS06090 (ACB338_06095) | - | 1193464..1193793 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| ACB338_RS06095 (ACB338_06100) | - | 1193849..1194055 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| ACB338_RS06100 (ACB338_06105) | - | 1194064..1194204 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| ACB338_RS06105 (ACB338_06110) | - | 1194201..1194434 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| ACB338_RS06110 (ACB338_06115) | - | 1194415..1194804 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| ACB338_RS06115 (ACB338_06120) | - | 1194949..1195188 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| ACB338_RS06120 (ACB338_06125) | - | 1195288..1195473 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| ACB338_RS06125 (ACB338_06130) | - | 1195475..1195786 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| ACB338_RS06130 (ACB338_06135) | - | 1195864..1196049 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| ACB338_RS06135 (ACB338_06140) | - | 1196216..1196455 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| ACB338_RS06140 (ACB338_06145) | - | 1196597..1197403 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| ACB338_RS06145 (ACB338_06150) | - | 1197338..1197604 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| ACB338_RS06150 (ACB338_06155) | - | 1197636..1198352 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| ACB338_RS06155 (ACB338_06160) | - | 1198364..1198555 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| ACB338_RS06160 (ACB338_06165) | - | 1199191..1199286 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| ACB338_RS06165 (ACB338_06170) | - | 1199709..1200056 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| ACB338_RS06170 (ACB338_06175) | - | 1200060..1200440 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB338_RS06175 (ACB338_06180) | - | 1200452..1200718 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| ACB338_RS06180 (ACB338_06185) | - | 1200842..1201984 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ACB338_RS06185 (ACB338_06190) | - | 1202074..1202349 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ACB338_RS06190 (ACB338_06195) | - | 1202448..1203035 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| ACB338_RS06195 (ACB338_06200) | - | 1203013..1203855 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1038083 ACB338_RS05905 WP_011017964.1 1168863..1169045(-) (prx) [Streptococcus pyogenes strain Isolate]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1038083 ACB338_RS05905 WP_011017964.1 1168863..1169045(-) (prx) [Streptococcus pyogenes strain Isolate]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |