Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB338_RS05060 | Genome accession | NZ_CP167024 |
| Coordinates | 1007122..1007310 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999538..1045848 | 1007122..1007310 | within | 0 |
Gene organization within MGE regions
Location: 999538..1045848
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB338_RS05025 (ACB338_05030) | pfkA | 999538..1000551 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| ACB338_RS05030 (ACB338_05035) | - | 1000631..1003741 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| ACB338_RS05035 (ACB338_05040) | - | 1003926..1004297 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| ACB338_RS05040 (ACB338_05045) | - | 1004297..1004995 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ACB338_RS05045 (ACB338_05050) | - | 1005005..1005790 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| ACB338_RS05050 (ACB338_05055) | - | 1005917..1006531 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| ACB338_RS05060 (ACB338_05065) | prx | 1007122..1007310 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| ACB338_RS05065 (ACB338_05070) | speA | 1007530..1008285 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| ACB338_RS05070 (ACB338_05075) | - | 1008407..1009066 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| ACB338_RS05075 (ACB338_05080) | - | 1009066..1009287 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| ACB338_RS05080 (ACB338_05085) | - | 1009297..1010070 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| ACB338_RS05085 (ACB338_05090) | - | 1010081..1010683 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| ACB338_RS05090 (ACB338_05095) | - | 1010695..1011459 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| ACB338_RS05095 (ACB338_05100) | - | 1011461..1011793 (-) | 333 | WP_011285562.1 | phage holin | - |
| ACB338_RS05100 (ACB338_05105) | - | 1011793..1012116 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| ACB338_RS05105 (ACB338_05110) | - | 1012130..1012252 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| ACB338_RS05110 (ACB338_05115) | - | 1012266..1012613 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| ACB338_RS05115 (ACB338_05120) | - | 1012624..1014486 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| ACB338_RS05120 (ACB338_05125) | - | 1014491..1017931 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| ACB338_RS05125 (ACB338_05130) | - | 1017932..1019416 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| ACB338_RS05130 (ACB338_05135) | - | 1019417..1021222 (-) | 1806 | WP_011054802.1 | tail protein | - |
| ACB338_RS05135 (ACB338_05140) | - | 1021215..1021673 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| ACB338_RS05140 (ACB338_05145) | - | 1021646..1021963 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| ACB338_RS05145 (ACB338_05150) | - | 1021976..1022482 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| ACB338_RS05150 (ACB338_05155) | - | 1022494..1022904 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| ACB338_RS05155 (ACB338_05160) | - | 1022906..1023301 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| ACB338_RS05160 (ACB338_05165) | - | 1023298..1023609 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| ACB338_RS05165 (ACB338_05170) | - | 1023606..1023950 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| ACB338_RS05170 (ACB338_05175) | - | 1023964..1024257 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| ACB338_RS05175 (ACB338_05180) | - | 1024270..1025160 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| ACB338_RS05180 (ACB338_05185) | - | 1025179..1025748 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| ACB338_RS05185 (ACB338_05190) | - | 1025857..1025991 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| ACB338_RS05190 (ACB338_05195) | - | 1025993..1026262 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| ACB338_RS05195 (ACB338_05200) | - | 1026269..1027177 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| ACB338_RS05200 (ACB338_05205) | - | 1027146..1028471 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| ACB338_RS05205 (ACB338_05210) | - | 1028471..1029745 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| ACB338_RS05210 (ACB338_05215) | - | 1029735..1030115 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| ACB338_RS05215 (ACB338_05220) | - | 1030725..1031159 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB338_RS05220 (ACB338_05225) | - | 1031445..1031711 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| ACB338_RS05225 (ACB338_05230) | - | 1031708..1032232 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| ACB338_RS05230 (ACB338_05235) | - | 1032235..1032867 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ACB338_RS05235 (ACB338_05240) | - | 1032869..1033153 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| ACB338_RS05240 (ACB338_05245) | - | 1033150..1033320 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| ACB338_RS05245 (ACB338_05250) | - | 1033317..1033553 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| ACB338_RS05250 (ACB338_05255) | - | 1033553..1033798 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| ACB338_RS05255 (ACB338_05260) | - | 1033795..1034151 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| ACB338_RS05260 (ACB338_05265) | - | 1034148..1034588 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACB338_RS05265 (ACB338_05270) | - | 1034588..1034791 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| ACB338_RS05270 (ACB338_05275) | ssb | 1034797..1035222 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| ACB338_RS05275 (ACB338_05280) | - | 1035215..1035889 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| ACB338_RS05280 (ACB338_05285) | - | 1035890..1036372 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| ACB338_RS05285 (ACB338_05290) | - | 1036394..1036648 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| ACB338_RS05290 (ACB338_05295) | - | 1036629..1036982 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| ACB338_RS05295 (ACB338_05300) | - | 1037123..1037905 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| ACB338_RS05300 (ACB338_05305) | - | 1037892..1038722 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACB338_RS05305 (ACB338_05310) | - | 1038736..1038924 (-) | 189 | Protein_996 | XRE family transcriptional regulator | - |
| ACB338_RS05310 (ACB338_05315) | - | 1039158..1039397 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| ACB338_RS05315 (ACB338_05320) | - | 1039528..1039737 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| ACB338_RS05320 (ACB338_05325) | - | 1039847..1040047 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| ACB338_RS05325 (ACB338_05330) | - | 1040121..1040507 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| ACB338_RS05330 (ACB338_05335) | - | 1040496..1040705 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| ACB338_RS05335 (ACB338_05340) | - | 1040759..1041358 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| ACB338_RS05340 (ACB338_05345) | - | 1041388..1041546 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| ACB338_RS05345 (ACB338_05350) | - | 1041903..1042727 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| ACB338_RS05350 (ACB338_05355) | - | 1042763..1043656 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| ACB338_RS05355 (ACB338_05360) | - | 1043777..1044865 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| ACB338_RS05360 (ACB338_05365) | - | 1045228..1045848 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=1038079 ACB338_RS05060 WP_011285559.1 1007122..1007310(-) (prx) [Streptococcus pyogenes strain Isolate]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1038079 ACB338_RS05060 WP_011285559.1 1007122..1007310(-) (prx) [Streptococcus pyogenes strain Isolate]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |