Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB339_RS07490 | Genome accession | NZ_CP167023 |
| Coordinates | 1410824..1411006 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 3 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1410824..1452328 | 1410824..1411006 | within | 0 |
Gene organization within MGE regions
Location: 1410824..1452328
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB339_RS07490 (ACB339_07485) | prx | 1410824..1411006 (-) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
| ACB339_RS07495 (ACB339_07490) | - | 1411239..1412225 (+) | 987 | WP_011106647.1 | DNA/RNA non-specific endonuclease | - |
| ACB339_RS07500 (ACB339_07495) | - | 1412339..1412854 (-) | 516 | WP_023077389.1 | hypothetical protein | - |
| ACB339_RS07505 (ACB339_07500) | - | 1413176..1414378 (-) | 1203 | WP_011184057.1 | glucosaminidase domain-containing protein | - |
| ACB339_RS07510 (ACB339_07505) | - | 1414494..1414721 (-) | 228 | WP_003058873.1 | phage holin | - |
| ACB339_RS07515 (ACB339_07510) | - | 1414718..1414990 (-) | 273 | WP_002986916.1 | hypothetical protein | - |
| ACB339_RS07520 (ACB339_07515) | - | 1415000..1415617 (-) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| ACB339_RS07525 (ACB339_07520) | - | 1415614..1416051 (-) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| ACB339_RS07530 (ACB339_07525) | - | 1416063..1418078 (-) | 2016 | WP_032461307.1 | gp58-like family protein | - |
| ACB339_RS07535 (ACB339_07530) | - | 1418088..1419095 (-) | 1008 | WP_011054441.1 | hyaluronoglucosaminidase | - |
| ACB339_RS07540 (ACB339_07535) | - | 1419092..1421071 (-) | 1980 | WP_011054864.1 | phage tail protein | - |
| ACB339_RS07545 (ACB339_07540) | - | 1421081..1421923 (-) | 843 | WP_011054865.1 | phage tail family protein | - |
| ACB339_RS07550 (ACB339_07545) | - | 1421935..1426317 (-) | 4383 | WP_011054866.1 | tape measure protein | - |
| ACB339_RS07555 (ACB339_07550) | - | 1426332..1426565 (-) | 234 | WP_011054867.1 | hypothetical protein | - |
| ACB339_RS07560 (ACB339_07555) | - | 1426640..1427095 (-) | 456 | WP_011054868.1 | tail assembly chaperone | - |
| ACB339_RS07565 (ACB339_07560) | - | 1427149..1427748 (-) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| ACB339_RS07570 (ACB339_07565) | - | 1427760..1428119 (-) | 360 | WP_011054870.1 | hypothetical protein | - |
| ACB339_RS07575 (ACB339_07570) | - | 1428123..1428467 (-) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACB339_RS07580 (ACB339_07575) | - | 1428464..1428742 (-) | 279 | WP_011054872.1 | hypothetical protein | - |
| ACB339_RS07585 (ACB339_07580) | - | 1428753..1429109 (-) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| ACB339_RS07590 (ACB339_07585) | - | 1429121..1430008 (-) | 888 | WP_002983429.1 | hypothetical protein | - |
| ACB339_RS07595 (ACB339_07590) | - | 1430021..1430590 (-) | 570 | WP_149031612.1 | DUF4355 domain-containing protein | - |
| ACB339_RS07600 (ACB339_07595) | - | 1430758..1431024 (-) | 267 | WP_011054875.1 | hypothetical protein | - |
| ACB339_RS07605 (ACB339_07600) | - | 1431029..1431217 (-) | 189 | WP_011054876.1 | hypothetical protein | - |
| ACB339_RS07610 (ACB339_07605) | - | 1431245..1432693 (-) | 1449 | WP_011054877.1 | minor capsid protein | - |
| ACB339_RS07615 (ACB339_07610) | - | 1432653..1434185 (-) | 1533 | WP_011106638.1 | phage portal protein | - |
| ACB339_RS07620 (ACB339_07615) | - | 1434201..1435478 (-) | 1278 | WP_371485014.1 | PBSX family phage terminase large subunit | - |
| ACB339_RS07625 (ACB339_07620) | - | 1435468..1435920 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ACB339_RS07630 (ACB339_07625) | - | 1436010..1436426 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| ACB339_RS07635 (ACB339_07630) | - | 1436559..1436831 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| ACB339_RS07640 (ACB339_07635) | - | 1436824..1436994 (-) | 171 | WP_011054883.1 | hypothetical protein | - |
| ACB339_RS07645 (ACB339_07640) | - | 1436995..1438317 (-) | 1323 | WP_011054884.1 | SNF2-related protein | - |
| ACB339_RS07650 (ACB339_07645) | - | 1438314..1438589 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| ACB339_RS07655 (ACB339_07650) | - | 1438955..1441339 (-) | 2385 | WP_011054886.1 | phage/plasmid primase, P4 family | - |
| ACB339_RS07660 (ACB339_07655) | - | 1441344..1443266 (-) | 1923 | WP_011054887.1 | DNA polymerase | - |
| ACB339_RS07665 (ACB339_07660) | - | 1443309..1443872 (-) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| ACB339_RS07670 (ACB339_07665) | - | 1443886..1445043 (-) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| ACB339_RS07675 (ACB339_07670) | - | 1445043..1445342 (-) | 300 | WP_000573833.1 | hypothetical protein | - |
| ACB339_RS07680 (ACB339_07675) | - | 1445430..1445633 (-) | 204 | WP_011054890.1 | hypothetical protein | - |
| ACB339_RS07685 (ACB339_07680) | - | 1445779..1446162 (-) | 384 | WP_011054892.1 | hypothetical protein | - |
| ACB339_RS07690 (ACB339_07685) | - | 1446159..1446366 (-) | 208 | Protein_1462 | hypothetical protein | - |
| ACB339_RS07695 (ACB339_07690) | - | 1446359..1446529 (-) | 171 | WP_011054894.1 | hypothetical protein | - |
| ACB339_RS07700 (ACB339_07695) | - | 1446558..1446815 (-) | 258 | WP_011054895.1 | hypothetical protein | - |
| ACB339_RS07705 (ACB339_07700) | - | 1446903..1447103 (-) | 201 | WP_011184050.1 | hypothetical protein | - |
| ACB339_RS07710 (ACB339_07705) | - | 1447154..1447345 (-) | 192 | WP_001283052.1 | hypothetical protein | - |
| ACB339_RS07715 (ACB339_07710) | - | 1447984..1448334 (+) | 351 | WP_011184049.1 | helix-turn-helix domain-containing protein | - |
| ACB339_RS07720 (ACB339_07715) | - | 1448348..1448731 (+) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB339_RS07725 (ACB339_07720) | - | 1448742..1449293 (+) | 552 | WP_011054899.1 | hypothetical protein | - |
| ACB339_RS07730 (ACB339_07725) | - | 1449469..1450557 (+) | 1089 | WP_011054900.1 | site-specific integrase | - |
| ACB339_RS07735 (ACB339_07730) | - | 1450700..1452328 (-) | 1629 | WP_011054901.1 | ABC transporter permease | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=1038040 ACB339_RS07490 WP_011054856.1 1410824..1411006(-) (prx) [Streptococcus pyogenes strain Isolate 3]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1038040 ACB339_RS07490 WP_011054856.1 1410824..1411006(-) (prx) [Streptococcus pyogenes strain Isolate 3]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |