Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB339_RS06890 | Genome accession | NZ_CP167023 |
| Coordinates | 1313379..1313561 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes strain Isolate 3 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1313379..1351348 | 1313379..1313561 | within | 0 |
Gene organization within MGE regions
Location: 1313379..1351348
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB339_RS06890 (ACB339_06885) | prx | 1313379..1313561 (-) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
| ACB339_RS06895 (ACB339_06890) | speA | 1313781..1314536 (+) | 756 | WP_011054794.1 | streptococcal pyrogenic exotoxin SpeA | - |
| ACB339_RS06900 (ACB339_06895) | - | 1314658..1315317 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| ACB339_RS06905 (ACB339_06900) | - | 1315317..1315538 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| ACB339_RS06910 (ACB339_06905) | - | 1315548..1316321 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| ACB339_RS06915 (ACB339_06910) | - | 1316332..1316935 (-) | 604 | Protein_1319 | hypothetical protein | - |
| ACB339_RS06920 (ACB339_06915) | - | 1316947..1317711 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| ACB339_RS06925 (ACB339_06920) | - | 1317713..1318045 (-) | 333 | WP_011054798.1 | phage holin | - |
| ACB339_RS06930 (ACB339_06925) | - | 1318381..1318503 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| ACB339_RS06935 (ACB339_06930) | - | 1318517..1318864 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| ACB339_RS06940 (ACB339_06935) | - | 1318875..1320737 (-) | 1863 | WP_011106671.1 | DUF859 family phage minor structural protein | - |
| ACB339_RS06945 (ACB339_06940) | - | 1320742..1324182 (-) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| ACB339_RS06950 (ACB339_06945) | - | 1324183..1325667 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| ACB339_RS06955 (ACB339_06950) | - | 1325668..1327473 (-) | 1806 | WP_011054802.1 | tail protein | - |
| ACB339_RS06960 (ACB339_06955) | - | 1327466..1327924 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| ACB339_RS06965 (ACB339_06960) | - | 1327897..1328214 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| ACB339_RS06970 (ACB339_06965) | - | 1328227..1328733 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| ACB339_RS06975 (ACB339_06970) | - | 1328745..1329155 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| ACB339_RS06980 (ACB339_06975) | - | 1329157..1329552 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| ACB339_RS06985 (ACB339_06980) | - | 1329549..1329860 (-) | 312 | WP_009880258.1 | hypothetical protein | - |
| ACB339_RS06990 (ACB339_06985) | - | 1329857..1330201 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| ACB339_RS06995 (ACB339_06990) | - | 1330215..1330508 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| ACB339_RS07000 (ACB339_06995) | - | 1330521..1331411 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| ACB339_RS07005 (ACB339_07000) | - | 1331429..1332001 (-) | 573 | WP_011054804.1 | DUF4355 domain-containing protein | - |
| ACB339_RS07010 (ACB339_07005) | - | 1332151..1332417 (-) | 267 | WP_011054805.1 | hypothetical protein | - |
| ACB339_RS07015 (ACB339_07010) | - | 1332424..1333332 (-) | 909 | WP_009880264.1 | minor capsid protein | - |
| ACB339_RS07020 (ACB339_07015) | - | 1333301..1334626 (-) | 1326 | WP_032461413.1 | phage portal protein | - |
| ACB339_RS07025 (ACB339_07020) | - | 1334626..1335900 (-) | 1275 | Protein_1341 | PBSX family phage terminase large subunit | - |
| ACB339_RS07030 (ACB339_07025) | - | 1335890..1336270 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| ACB339_RS07035 (ACB339_07030) | - | 1336880..1337314 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB339_RS07040 (ACB339_07035) | - | 1337598..1337768 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| ACB339_RS07045 (ACB339_07040) | - | 1337765..1338268 (-) | 504 | WP_011054811.1 | DUF1642 domain-containing protein | - |
| ACB339_RS07050 (ACB339_07045) | - | 1338555..1338740 (-) | 186 | WP_011054812.1 | hypothetical protein | - |
| ACB339_RS07055 (ACB339_07050) | - | 1338906..1339241 (-) | 336 | WP_011054813.1 | hypothetical protein | - |
| ACB339_RS07060 (ACB339_07055) | - | 1339244..1339528 (-) | 285 | WP_032461310.1 | hypothetical protein | - |
| ACB339_RS07065 (ACB339_07060) | - | 1339525..1339695 (-) | 171 | WP_011054814.1 | hypothetical protein | - |
| ACB339_RS07070 (ACB339_07065) | - | 1339692..1340105 (-) | 414 | WP_011054815.1 | YopX family protein | - |
| ACB339_RS07075 (ACB339_07070) | - | 1340102..1340386 (-) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| ACB339_RS07080 (ACB339_07075) | - | 1340380..1340631 (-) | 252 | WP_011106665.1 | hypothetical protein | - |
| ACB339_RS07085 (ACB339_07080) | - | 1340628..1340984 (-) | 357 | WP_011054816.1 | hypothetical protein | - |
| ACB339_RS07090 (ACB339_07085) | - | 1340968..1341288 (-) | 321 | WP_011054817.1 | VRR-NUC domain-containing protein | - |
| ACB339_RS07095 (ACB339_07090) | - | 1341533..1342546 (-) | 1014 | WP_227874757.1 | phage/plasmid primase, P4 family | - |
| ACB339_RS07100 (ACB339_07095) | - | 1342459..1343013 (-) | 555 | WP_011054578.1 | hypothetical protein | - |
| ACB339_RS07105 (ACB339_07100) | - | 1343003..1343815 (-) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| ACB339_RS07110 (ACB339_07105) | - | 1343818..1344276 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| ACB339_RS07115 (ACB339_07110) | - | 1344292..1345521 (-) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| ACB339_RS07120 (ACB339_07115) | - | 1345623..1346303 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| ACB339_RS07125 (ACB339_07120) | - | 1346304..1346786 (-) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| ACB339_RS07130 (ACB339_07125) | - | 1347015..1347329 (-) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| ACB339_RS07135 (ACB339_07130) | - | 1347345..1347482 (-) | 138 | WP_011054821.1 | hypothetical protein | - |
| ACB339_RS07140 (ACB339_07135) | - | 1347513..1347764 (-) | 252 | WP_011054822.1 | AlpA family transcriptional regulator | - |
| ACB339_RS07145 (ACB339_07140) | - | 1347859..1348077 (-) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| ACB339_RS07150 (ACB339_07145) | - | 1348266..1348625 (+) | 360 | WP_032461558.1 | helix-turn-helix transcriptional regulator | - |
| ACB339_RS07155 (ACB339_07150) | - | 1348609..1348986 (+) | 378 | WP_032461557.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB339_RS07160 (ACB339_07155) | - | 1348997..1349149 (+) | 153 | WP_011054825.1 | hypothetical protein | - |
| ACB339_RS07165 (ACB339_07160) | - | 1349418..1350008 (+) | 591 | WP_009880743.1 | hypothetical protein | - |
| ACB339_RS07170 (ACB339_07165) | - | 1350182..1351348 (+) | 1167 | WP_009880742.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
>NTDB_id=1038036 ACB339_RS06890 WP_011054793.1 1313379..1313561(-) (prx) [Streptococcus pyogenes strain Isolate 3]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1038036 ACB339_RS06890 WP_011054793.1 1313379..1313561(-) (prx) [Streptococcus pyogenes strain Isolate 3]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |