Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB339_RS05835 | Genome accession | NZ_CP167023 |
| Coordinates | 1137834..1138016 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054671.1 | Uniprot ID | Q4VUT1 |
| Organism | Streptococcus pyogenes strain Isolate 3 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1137834..1173846 | 1137834..1138016 | within | 0 |
Gene organization within MGE regions
Location: 1137834..1173846
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB339_RS05835 (ACB339_05830) | prx | 1137834..1138016 (-) | 183 | WP_011054671.1 | hypothetical protein | Regulator |
| ACB339_RS05840 (ACB339_05835) | - | 1138083..1138877 (-) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| ACB339_RS05845 (ACB339_05840) | - | 1139122..1140336 (-) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| ACB339_RS05850 (ACB339_05845) | - | 1140448..1140903 (-) | 456 | WP_002983475.1 | phage holin family protein | - |
| ACB339_RS05855 (ACB339_05850) | - | 1140914..1141528 (-) | 615 | WP_011054672.1 | DUF1366 domain-containing protein | - |
| ACB339_RS05860 (ACB339_05855) | - | 1141531..1141962 (-) | 432 | WP_011054673.1 | DUF1617 family protein | - |
| ACB339_RS05865 (ACB339_05860) | - | 1141971..1143752 (-) | 1782 | WP_011054674.1 | gp58-like family protein | - |
| ACB339_RS05870 (ACB339_05865) | - | 1143767..1144876 (-) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| ACB339_RS05875 (ACB339_05870) | - | 1144876..1146849 (-) | 1974 | WP_032461270.1 | phage tail spike protein | - |
| ACB339_RS05880 (ACB339_05875) | - | 1146831..1147526 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| ACB339_RS05885 (ACB339_05880) | - | 1147523..1149886 (-) | 2364 | WP_011054677.1 | hypothetical protein | - |
| ACB339_RS05890 (ACB339_05885) | - | 1149886..1150257 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| ACB339_RS05895 (ACB339_05890) | - | 1150272..1150535 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| ACB339_RS05900 (ACB339_05895) | - | 1150546..1151136 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| ACB339_RS05905 (ACB339_05900) | - | 1151152..1151487 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| ACB339_RS05910 (ACB339_05905) | - | 1151488..1151724 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| ACB339_RS05915 (ACB339_05910) | - | 1151717..1152055 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| ACB339_RS05920 (ACB339_05915) | - | 1152015..1152437 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ACB339_RS05925 (ACB339_05920) | - | 1152447..1152647 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| ACB339_RS05930 (ACB339_05925) | - | 1152647..1153558 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| ACB339_RS05935 (ACB339_05930) | - | 1153583..1154044 (-) | 462 | WP_011054684.1 | DUF4355 domain-containing protein | - |
| ACB339_RS05940 (ACB339_05935) | - | 1154125..1155540 (-) | 1416 | WP_011054685.1 | terminase | - |
| ACB339_RS05945 (ACB339_05940) | - | 1155622..1155837 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| ACB339_RS05950 (ACB339_05945) | - | 1155839..1156105 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| ACB339_RS05955 (ACB339_05950) | - | 1156098..1156250 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| ACB339_RS05960 (ACB339_05955) | - | 1156327..1156551 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| ACB339_RS05965 (ACB339_05960) | - | 1156557..1158050 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| ACB339_RS05970 (ACB339_05965) | - | 1158043..1159311 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| ACB339_RS05975 (ACB339_05970) | - | 1159308..1159664 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| ACB339_RS05980 (ACB339_05975) | - | 1159812..1160156 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| ACB339_RS05985 (ACB339_05980) | - | 1160264..1160683 (-) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| ACB339_RS05990 (ACB339_05985) | - | 1160759..1161010 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| ACB339_RS05995 (ACB339_05990) | - | 1161007..1161162 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| ACB339_RS06000 (ACB339_05995) | - | 1161159..1161476 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| ACB339_RS06005 (ACB339_06000) | - | 1161512..1162024 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| ACB339_RS06010 (ACB339_06005) | - | 1162021..1162353 (-) | 333 | WP_011054696.1 | hypothetical protein | - |
| ACB339_RS06015 (ACB339_06010) | - | 1162364..1163710 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| ACB339_RS06020 (ACB339_06015) | - | 1163707..1164102 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| ACB339_RS06025 (ACB339_06020) | - | 1164467..1165264 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACB339_RS06030 (ACB339_06025) | - | 1165257..1165457 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| ACB339_RS06035 (ACB339_06030) | - | 1165454..1166380 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| ACB339_RS06040 (ACB339_06035) | - | 1166383..1166713 (-) | 331 | Protein_1145 | hypothetical protein | - |
| ACB339_RS06045 (ACB339_06040) | - | 1166769..1166975 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| ACB339_RS06050 (ACB339_06045) | - | 1166984..1167124 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| ACB339_RS06055 (ACB339_06050) | - | 1167121..1167354 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| ACB339_RS06060 (ACB339_06055) | - | 1167335..1167721 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| ACB339_RS06065 (ACB339_06060) | - | 1167862..1168131 (-) | 270 | WP_011106700.1 | replication protein | - |
| ACB339_RS06070 (ACB339_06065) | - | 1168225..1168410 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| ACB339_RS06075 (ACB339_06070) | - | 1168412..1168723 (-) | 312 | WP_010922478.1 | excisionase | - |
| ACB339_RS06080 (ACB339_06075) | - | 1168993..1169205 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| ACB339_RS06085 (ACB339_06080) | - | 1169407..1170162 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| ACB339_RS06090 (ACB339_06085) | - | 1170174..1170692 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| ACB339_RS06095 (ACB339_06090) | - | 1170816..1171958 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ACB339_RS06100 (ACB339_06095) | - | 1172047..1172322 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ACB339_RS06105 (ACB339_06100) | - | 1172421..1173008 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| ACB339_RS06110 (ACB339_06105) | - | 1172986..1173828 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6978.99 Da Isoelectric Point: 4.3466
>NTDB_id=1038031 ACB339_RS05835 WP_011054671.1 1137834..1138016(-) (prx) [Streptococcus pyogenes strain Isolate 3]
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1038031 ACB339_RS05835 WP_011054671.1 1137834..1138016(-) (prx) [Streptococcus pyogenes strain Isolate 3]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |