Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB339_RS05000 | Genome accession | NZ_CP167023 |
| Coordinates | 977614..977796 (-) | Length | 60 a.a. |
| NCBI ID | WP_029714017.1 | Uniprot ID | A0A5S4TLJ0 |
| Organism | Streptococcus pyogenes strain Isolate 3 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 977614..1019351 | 977614..977796 | within | 0 |
Gene organization within MGE regions
Location: 977614..1019351
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB339_RS05000 (ACB339_04995) | prx | 977614..977796 (-) | 183 | WP_029714017.1 | hypothetical protein | Regulator |
| ACB339_RS05005 (ACB339_05000) | - | 977995..978204 (-) | 210 | WP_011054450.1 | helix-turn-helix domain-containing protein | - |
| ACB339_RS05010 (ACB339_05005) | - | 978358..978504 (+) | 147 | WP_011054449.1 | hypothetical protein | - |
| ACB339_RS05015 (ACB339_05010) | - | 978645..978896 (+) | 252 | WP_011054448.1 | hypothetical protein | - |
| ACB339_RS05020 (ACB339_05015) | - | 979160..979399 (+) | 240 | WP_011054447.1 | hypothetical protein | - |
| ACB339_RS05025 (ACB339_05020) | - | 979457..979813 (+) | 357 | WP_011054446.1 | hypothetical protein | - |
| ACB339_RS05030 (ACB339_05025) | - | 979929..981137 (-) | 1209 | WP_136301353.1 | glucosaminidase domain-containing protein | - |
| ACB339_RS05035 (ACB339_05030) | - | 981253..981480 (-) | 228 | WP_011054444.1 | phage holin | - |
| ACB339_RS05040 (ACB339_05035) | - | 981477..981752 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| ACB339_RS05045 (ACB339_05040) | - | 981762..982379 (-) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
| ACB339_RS05050 (ACB339_05045) | - | 982382..982813 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| ACB339_RS05055 (ACB339_05050) | - | 982825..984843 (-) | 2019 | WP_011106754.1 | gp58-like family protein | - |
| ACB339_RS05060 (ACB339_05055) | - | 984853..985962 (-) | 1110 | WP_023609821.1 | hyaluronidase HylP | - |
| ACB339_RS05065 (ACB339_05060) | - | 985962..988109 (-) | 2148 | WP_023605202.1 | phage tail spike protein | - |
| ACB339_RS05070 (ACB339_05065) | - | 988106..988813 (-) | 708 | WP_011054553.1 | distal tail protein Dit | - |
| ACB339_RS05075 (ACB339_05070) | - | 988813..992736 (-) | 3924 | WP_011054554.1 | phage tail tape measure protein | - |
| ACB339_RS05080 (ACB339_05075) | - | 992749..992898 (-) | 150 | WP_023609816.1 | hypothetical protein | - |
| ACB339_RS05085 (ACB339_05080) | gpG | 992946..993272 (-) | 327 | WP_011054556.1 | phage tail assembly chaperone G | - |
| ACB339_RS05090 (ACB339_05085) | - | 993325..993936 (-) | 612 | WP_011054557.1 | major tail protein | - |
| ACB339_RS05095 (ACB339_05090) | - | 993955..994380 (-) | 426 | WP_011054558.1 | hypothetical protein | - |
| ACB339_RS05100 (ACB339_05095) | - | 994377..994754 (-) | 378 | WP_011054559.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACB339_RS05105 (ACB339_05100) | - | 994751..995089 (-) | 339 | WP_011054560.1 | phage head closure protein | - |
| ACB339_RS05110 (ACB339_05105) | - | 995086..995388 (-) | 303 | WP_011054561.1 | head-tail connector protein | - |
| ACB339_RS05115 (ACB339_05110) | - | 995391..995519 (-) | 129 | WP_011054562.1 | hypothetical protein | - |
| ACB339_RS05120 (ACB339_05115) | - | 995533..996717 (-) | 1185 | WP_011054563.1 | phage major capsid protein | - |
| ACB339_RS05125 (ACB339_05120) | - | 996743..997408 (-) | 666 | WP_011054564.1 | head maturation protease, ClpP-related | - |
| ACB339_RS05130 (ACB339_05125) | - | 997386..998606 (-) | 1221 | WP_011054565.1 | phage portal protein | - |
| ACB339_RS05135 (ACB339_05130) | - | 998640..998906 (-) | 267 | WP_011054566.1 | hypothetical protein | - |
| ACB339_RS05140 (ACB339_05135) | - | 998899..999069 (-) | 171 | WP_011054567.1 | hypothetical protein | - |
| ACB339_RS05145 (ACB339_05140) | - | 999066..1000820 (-) | 1755 | WP_011054568.1 | terminase large subunit | - |
| ACB339_RS05150 (ACB339_05145) | - | 1000835..1001302 (-) | 468 | WP_011054569.1 | phage terminase small subunit P27 family | - |
| ACB339_RS05155 (ACB339_05150) | - | 1001474..1001812 (-) | 339 | WP_002985375.1 | HNH endonuclease | - |
| ACB339_RS05160 (ACB339_05155) | - | 1002398..1002838 (-) | 441 | WP_011054571.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB339_RS05165 (ACB339_05160) | - | 1003111..1003746 (-) | 636 | WP_011054572.1 | N-6 DNA methylase | - |
| ACB339_RS05170 (ACB339_05165) | - | 1003746..1004147 (-) | 402 | WP_011054573.1 | hypothetical protein | - |
| ACB339_RS05175 (ACB339_05170) | - | 1004338..1004712 (-) | 375 | WP_011054574.1 | methyltransferase domain-containing protein | - |
| ACB339_RS05180 (ACB339_05175) | - | 1004737..1005021 (-) | 285 | WP_011106747.1 | hypothetical protein | - |
| ACB339_RS05185 (ACB339_05180) | - | 1005018..1005221 (-) | 204 | WP_011054575.1 | hypothetical protein | - |
| ACB339_RS05190 (ACB339_05185) | - | 1005205..1005525 (-) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| ACB339_RS05195 (ACB339_05190) | - | 1005522..1005935 (-) | 414 | WP_008087509.1 | hypothetical protein | - |
| ACB339_RS05200 (ACB339_05195) | - | 1006197..1007671 (-) | 1475 | Protein_977 | phage/plasmid primase, P4 family | - |
| ACB339_RS05205 (ACB339_05200) | - | 1007661..1008473 (-) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| ACB339_RS05210 (ACB339_05205) | - | 1008476..1008934 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| ACB339_RS05215 (ACB339_05210) | - | 1008950..1010179 (-) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| ACB339_RS05220 (ACB339_05215) | - | 1010281..1010961 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| ACB339_RS05225 (ACB339_05220) | - | 1010962..1011444 (-) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| ACB339_RS05230 (ACB339_05225) | - | 1011673..1011987 (-) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| ACB339_RS05235 (ACB339_05230) | - | 1012003..1012137 (-) | 135 | WP_002995985.1 | hypothetical protein | - |
| ACB339_RS05240 (ACB339_05235) | - | 1012134..1012430 (-) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| ACB339_RS05245 (ACB339_05240) | - | 1012508..1012693 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| ACB339_RS05250 (ACB339_05245) | - | 1012860..1013099 (+) | 240 | WP_011054586.1 | hypothetical protein | - |
| ACB339_RS05255 (ACB339_05250) | - | 1013250..1013459 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| ACB339_RS05260 (ACB339_05255) | - | 1013675..1013914 (-) | 240 | WP_011054588.1 | helix-turn-helix transcriptional regulator | - |
| ACB339_RS05265 (ACB339_05260) | - | 1013988..1014374 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| ACB339_RS05270 (ACB339_05265) | - | 1014363..1014569 (-) | 207 | WP_011054590.1 | hypothetical protein | - |
| ACB339_RS05275 (ACB339_05270) | - | 1014626..1015405 (+) | 780 | WP_011054591.1 | hypothetical protein | - |
| ACB339_RS05280 (ACB339_05275) | - | 1015539..1015685 (-) | 147 | WP_011054593.1 | hypothetical protein | - |
| ACB339_RS05285 (ACB339_05280) | - | 1016057..1016845 (+) | 789 | WP_021340822.1 | S24 family peptidase | - |
| ACB339_RS05290 (ACB339_05285) | - | 1016855..1017160 (+) | 306 | WP_011106738.1 | membrane protein | - |
| ACB339_RS05295 (ACB339_05290) | - | 1017280..1018368 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| ACB339_RS05300 (ACB339_05295) | - | 1018731..1019351 (+) | 621 | WP_011054596.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6890.90 Da Isoelectric Point: 4.1947
>NTDB_id=1038028 ACB339_RS05000 WP_029714017.1 977614..977796(-) (prx) [Streptococcus pyogenes strain Isolate 3]
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1038028 ACB339_RS05000 WP_029714017.1 977614..977796(-) (prx) [Streptococcus pyogenes strain Isolate 3]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |