Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB339_RS04085 | Genome accession | NZ_CP167023 |
| Coordinates | 788353..788541 (+) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain Isolate 3 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 748955..790662 | 788353..788541 | within | 0 |
Gene organization within MGE regions
Location: 748955..790662
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB339_RS03805 (ACB339_03800) | - | 748955..750151 (-) | 1197 | WP_011017350.1 | site-specific integrase | - |
| ACB339_RS03810 (ACB339_03805) | - | 750462..751202 (-) | 741 | WP_011017351.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| ACB339_RS03815 (ACB339_03810) | - | 751213..751605 (-) | 393 | WP_011017352.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB339_RS03820 (ACB339_03815) | - | 751609..751959 (-) | 351 | WP_011017353.1 | helix-turn-helix domain-containing protein | - |
| ACB339_RS03825 (ACB339_03820) | - | 752248..752523 (+) | 276 | WP_011017354.1 | hypothetical protein | - |
| ACB339_RS03830 (ACB339_03825) | - | 752558..752770 (+) | 213 | WP_011054420.1 | helix-turn-helix domain-containing protein | - |
| ACB339_RS03835 (ACB339_03830) | - | 752844..752978 (+) | 135 | WP_011017356.1 | hypothetical protein | - |
| ACB339_RS03840 (ACB339_03835) | - | 753098..753607 (-) | 510 | WP_011106801.1 | hypothetical protein | - |
| ACB339_RS03845 (ACB339_03840) | - | 753649..754368 (+) | 720 | WP_011017357.1 | ORF6C domain-containing protein | - |
| ACB339_RS03850 (ACB339_03845) | - | 754442..754699 (+) | 258 | WP_011054421.1 | hypothetical protein | - |
| ACB339_RS03855 (ACB339_03850) | - | 754792..754983 (+) | 192 | WP_011017359.1 | hypothetical protein | - |
| ACB339_RS03860 (ACB339_03855) | - | 755104..755292 (+) | 189 | WP_032461348.1 | hypothetical protein | - |
| ACB339_RS03865 (ACB339_03860) | dnaB | 755279..756619 (+) | 1341 | WP_011017360.1 | replicative DNA helicase | - |
| ACB339_RS03870 (ACB339_03865) | - | 756612..757373 (+) | 762 | WP_011054422.1 | conserved phage C-terminal domain-containing protein | - |
| ACB339_RS03875 (ACB339_03870) | - | 757373..758185 (+) | 813 | Protein_713 | ATP-binding protein | - |
| ACB339_RS03880 (ACB339_03875) | - | 758185..758412 (+) | 228 | WP_011054424.1 | hypothetical protein | - |
| ACB339_RS03885 (ACB339_03880) | - | 758426..758632 (+) | 207 | WP_011054425.1 | hypothetical protein | - |
| ACB339_RS03890 (ACB339_03885) | - | 758649..759083 (+) | 435 | WP_011054426.1 | YopX family protein | - |
| ACB339_RS03895 (ACB339_03890) | - | 759080..759364 (+) | 285 | WP_011054427.1 | hypothetical protein | - |
| ACB339_RS03900 (ACB339_03895) | - | 759366..759998 (+) | 633 | WP_011054428.1 | N-6 DNA methylase | - |
| ACB339_RS03905 (ACB339_03900) | - | 760003..760515 (+) | 513 | WP_011054429.1 | DUF1642 domain-containing protein | - |
| ACB339_RS03910 (ACB339_03905) | - | 760475..760666 (+) | 192 | Protein_720 | single-stranded DNA-binding protein | - |
| ACB339_RS03915 (ACB339_03910) | - | 760681..760962 (+) | 282 | WP_011054431.1 | hypothetical protein | - |
| ACB339_RS03920 (ACB339_03915) | - | 760959..761297 (+) | 339 | WP_011054432.1 | helix-turn-helix domain-containing protein | - |
| ACB339_RS03925 (ACB339_03920) | - | 761299..762126 (+) | 828 | WP_011054433.1 | prohibitin family protein | - |
| ACB339_RS03930 (ACB339_03925) | - | 762141..762542 (+) | 402 | WP_011017373.1 | hypothetical protein | - |
| ACB339_RS03935 (ACB339_03930) | - | 762702..763277 (+) | 576 | WP_011054435.1 | site-specific integrase | - |
| ACB339_RS03940 (ACB339_03935) | - | 763431..763724 (+) | 294 | WP_011017375.1 | hypothetical protein | - |
| ACB339_RS03945 (ACB339_03940) | - | 763782..763985 (+) | 204 | WP_011017376.1 | hypothetical protein | - |
| ACB339_RS03950 (ACB339_03945) | - | 764011..764397 (+) | 387 | WP_011017377.1 | hypothetical protein | - |
| ACB339_RS03955 (ACB339_03950) | - | 764390..764695 (+) | 306 | WP_011017378.1 | HNH endonuclease | - |
| ACB339_RS03960 (ACB339_03955) | - | 764836..765153 (+) | 318 | WP_011017379.1 | P27 family phage terminase small subunit | - |
| ACB339_RS03965 (ACB339_03960) | - | 765166..766896 (+) | 1731 | WP_011017380.1 | terminase large subunit domain-containing protein | - |
| ACB339_RS03970 (ACB339_03965) | - | 766899..767111 (+) | 213 | WP_136260634.1 | hypothetical protein | - |
| ACB339_RS03975 (ACB339_03970) | - | 767264..768451 (+) | 1188 | WP_011017381.1 | phage portal protein | - |
| ACB339_RS03980 (ACB339_03975) | - | 768432..769238 (+) | 807 | WP_011017382.1 | head maturation protease, ClpP-related | - |
| ACB339_RS03985 (ACB339_03980) | - | 769255..770388 (+) | 1134 | WP_011017383.1 | phage major capsid protein | - |
| ACB339_RS03990 (ACB339_03985) | - | 770402..770575 (+) | 174 | WP_011017384.1 | hypothetical protein | - |
| ACB339_RS03995 (ACB339_03990) | - | 770575..770883 (+) | 309 | WP_011054437.1 | hypothetical protein | - |
| ACB339_RS04000 (ACB339_03995) | - | 770876..771238 (+) | 363 | WP_011017386.1 | hypothetical protein | - |
| ACB339_RS04005 (ACB339_04000) | - | 771240..771638 (+) | 399 | WP_011017387.1 | HK97 gp10 family phage protein | - |
| ACB339_RS04010 (ACB339_04005) | - | 771631..772011 (+) | 381 | WP_011017388.1 | hypothetical protein | - |
| ACB339_RS04015 (ACB339_04010) | - | 772023..772607 (+) | 585 | WP_011017389.1 | major tail protein | - |
| ACB339_RS04020 (ACB339_04015) | gpG | 772700..773002 (+) | 303 | WP_011017390.1 | phage tail assembly chaperone G | - |
| ACB339_RS04025 (ACB339_04020) | - | 773228..777328 (+) | 4101 | WP_011054439.1 | phage tail tape measure protein | - |
| ACB339_RS04030 (ACB339_04025) | - | 777341..778111 (+) | 771 | WP_011017392.1 | distal tail protein Dit | - |
| ACB339_RS04035 (ACB339_04030) | - | 778108..780159 (+) | 2052 | WP_011054440.1 | phage tail spike protein | - |
| ACB339_RS04040 (ACB339_04035) | - | 780156..781162 (+) | 1007 | Protein_746 | hyaluronoglucosaminidase | - |
| ACB339_RS04045 (ACB339_04040) | - | 781172..783076 (+) | 1905 | WP_011054442.1 | gp58-like family protein | - |
| ACB339_RS04050 (ACB339_04045) | - | 783088..783516 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| ACB339_RS04055 (ACB339_04050) | - | 783519..784151 (+) | 633 | WP_011054443.1 | hypothetical protein | - |
| ACB339_RS04060 (ACB339_04055) | - | 784163..784435 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| ACB339_RS04065 (ACB339_04060) | - | 784432..784659 (+) | 228 | WP_011054444.1 | phage holin | - |
| ACB339_RS04070 (ACB339_04065) | - | 784775..785983 (+) | 1209 | WP_011054548.1 | glucosaminidase domain-containing protein | - |
| ACB339_RS04075 (ACB339_04070) | - | 786121..787245 (+) | 1125 | WP_011054547.1 | Fic family protein | - |
| ACB339_RS04080 (ACB339_04075) | entC3 | 787458..788240 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| ACB339_RS04085 (ACB339_04080) | prx | 788353..788541 (+) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| ACB339_RS04095 (ACB339_04090) | - | 789132..789746 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| ACB339_RS04100 (ACB339_04095) | - | 789877..790662 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=1038024 ACB339_RS04085 WP_011054546.1 788353..788541(+) (prx) [Streptococcus pyogenes strain Isolate 3]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1038024 ACB339_RS04085 WP_011054546.1 788353..788541(+) (prx) [Streptococcus pyogenes strain Isolate 3]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |