Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB363_RS03135 | Genome accession | NZ_CP167021 |
| Coordinates | 600564..600746 (+) | Length | 60 a.a. |
| NCBI ID | WP_002986897.1 | Uniprot ID | A0A660A6E2 |
| Organism | Streptococcus pyogenes strain Isolate 5 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 559367..600746 | 600564..600746 | within | 0 |
Gene organization within MGE regions
Location: 559367..600746
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB363_RS02805 (ACB363_02805) | - | 559367..560464 (-) | 1098 | WP_032463383.1 | site-specific integrase | - |
| ACB363_RS02810 (ACB363_02810) | - | 560640..561161 (-) | 522 | WP_002986895.1 | hypothetical protein | - |
| ACB363_RS02815 (ACB363_02815) | - | 561172..561552 (-) | 381 | WP_076634137.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB363_RS02820 (ACB363_02820) | - | 561566..561925 (-) | 360 | WP_011054768.1 | helix-turn-helix domain-containing protein | - |
| ACB363_RS02825 (ACB363_02825) | - | 562344..562439 (-) | 96 | WP_020837683.1 | type I toxin-antitoxin system Fst family toxin | - |
| ACB363_RS02830 (ACB363_02830) | - | 563074..563265 (+) | 192 | WP_002986891.1 | hypothetical protein | - |
| ACB363_RS02835 (ACB363_02835) | - | 563276..564004 (+) | 729 | WP_002986890.1 | phage antirepressor KilAC domain-containing protein | - |
| ACB363_RS02840 (ACB363_02840) | - | 564037..564186 (+) | 150 | WP_002986888.1 | hypothetical protein | - |
| ACB363_RS02845 (ACB363_02845) | - | 564183..564383 (-) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| ACB363_RS02850 (ACB363_02850) | - | 564462..564710 (+) | 249 | WP_023611035.1 | hypothetical protein | - |
| ACB363_RS02855 (ACB363_02855) | - | 564684..564899 (-) | 216 | WP_023611028.1 | hypothetical protein | - |
| ACB363_RS02860 (ACB363_02860) | - | 565005..565262 (+) | 258 | WP_032463372.1 | hypothetical protein | - |
| ACB363_RS02865 (ACB363_02865) | - | 565291..565476 (+) | 186 | WP_002986881.1 | hypothetical protein | - |
| ACB363_RS02870 (ACB363_02870) | - | 565570..565827 (+) | 258 | WP_019418742.1 | hypothetical protein | - |
| ACB363_RS02875 (ACB363_02875) | - | 565949..566359 (+) | 411 | WP_172450154.1 | DnaD domain-containing protein | - |
| ACB363_RS02880 (ACB363_02880) | - | 566340..566552 (+) | 213 | WP_002986875.1 | hypothetical protein | - |
| ACB363_RS02885 (ACB363_02885) | - | 566558..566698 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| ACB363_RS02890 (ACB363_02890) | - | 566707..566913 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| ACB363_RS02895 (ACB363_02895) | - | 566969..567298 (+) | 330 | WP_076634469.1 | hypothetical protein | - |
| ACB363_RS02900 (ACB363_02900) | - | 567301..568227 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| ACB363_RS02905 (ACB363_02905) | - | 568224..568424 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| ACB363_RS02910 (ACB363_02910) | - | 568417..569214 (+) | 798 | WP_136022701.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACB363_RS02915 (ACB363_02915) | - | 569224..569391 (+) | 168 | WP_009880273.1 | hypothetical protein | - |
| ACB363_RS02920 (ACB363_02920) | - | 569568..569906 (+) | 339 | WP_002990067.1 | hypothetical protein | - |
| ACB363_RS02925 (ACB363_02925) | - | 569903..570415 (+) | 513 | WP_111695843.1 | hypothetical protein | - |
| ACB363_RS02930 (ACB363_02930) | - | 570402..570599 (+) | 198 | WP_011017567.1 | hypothetical protein | - |
| ACB363_RS02935 (ACB363_02935) | - | 570593..570877 (+) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| ACB363_RS02940 (ACB363_02940) | - | 570874..571143 (+) | 270 | WP_002987593.1 | hypothetical protein | - |
| ACB363_RS02945 (ACB363_02945) | - | 571153..571566 (+) | 414 | WP_032460569.1 | YopX family protein | - |
| ACB363_RS02950 (ACB363_02950) | - | 571563..571847 (+) | 285 | WP_032460570.1 | hypothetical protein | - |
| ACB363_RS02955 (ACB363_02955) | - | 571849..572484 (+) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| ACB363_RS02960 (ACB363_02960) | - | 572751..573188 (+) | 438 | WP_063632985.1 | DUF1492 domain-containing protein | - |
| ACB363_RS02965 (ACB363_02965) | - | 573522..574688 (+) | 1167 | WP_019418850.1 | DNA modification methylase | - |
| ACB363_RS02970 (ACB363_02970) | - | 575031..575507 (+) | 477 | WP_010922073.1 | hypothetical protein | - |
| ACB363_RS02975 (ACB363_02975) | - | 575590..576801 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| ACB363_RS02980 (ACB363_02980) | - | 576815..578317 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| ACB363_RS02985 (ACB363_02985) | - | 578322..579800 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| ACB363_RS02990 (ACB363_02990) | - | 579772..580011 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| ACB363_RS02995 (ACB363_02995) | - | 580073..580339 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| ACB363_RS03000 (ACB363_03000) | - | 580465..581079 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| ACB363_RS03005 (ACB363_03005) | - | 581083..581901 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| ACB363_RS03010 (ACB363_03010) | - | 581955..582371 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| ACB363_RS03015 (ACB363_03015) | - | 582361..582693 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| ACB363_RS03020 (ACB363_03020) | - | 582693..583049 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| ACB363_RS03025 (ACB363_03025) | - | 583046..583444 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| ACB363_RS03030 (ACB363_03030) | - | 583444..583929 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| ACB363_RS03035 (ACB363_03035) | - | 583968..584402 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| ACB363_RS03040 (ACB363_03040) | - | 584406..584987 (+) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| ACB363_RS03045 (ACB363_03045) | - | 584977..588237 (+) | 3261 | Protein_549 | tape measure protein | - |
| ACB363_RS03050 (ACB363_03050) | - | 588234..588950 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| ACB363_RS03055 (ACB363_03055) | - | 588947..591094 (+) | 2148 | WP_011284971.1 | phage tail spike protein | - |
| ACB363_RS03060 (ACB363_03060) | - | 591091..592305 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| ACB363_RS03065 (ACB363_03065) | - | 592307..592621 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| ACB363_RS03070 (ACB363_03070) | - | 592632..594521 (+) | 1890 | WP_047235372.1 | gp58-like family protein | - |
| ACB363_RS03075 (ACB363_03075) | - | 594533..594961 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| ACB363_RS03080 (ACB363_03080) | - | 594964..595596 (+) | 633 | WP_011054443.1 | hypothetical protein | - |
| ACB363_RS03085 (ACB363_03085) | - | 595608..595880 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| ACB363_RS03090 (ACB363_03090) | - | 595877..596104 (+) | 228 | WP_000609113.1 | phage holin | - |
| ACB363_RS03095 (ACB363_03095) | - | 596220..597422 (+) | 1203 | WP_023611747.1 | glucosaminidase domain-containing protein | - |
| ACB363_RS03100 (ACB363_03100) | - | 597609..597848 (-) | 240 | WP_003055855.1 | hypothetical protein | - |
| ACB363_RS03105 (ACB363_03105) | - | 597917..598132 (-) | 216 | WP_023611751.1 | hypothetical protein | - |
| ACB363_RS03110 (ACB363_03110) | - | 598134..598736 (-) | 603 | WP_023611748.1 | AP endonuclease | - |
| ACB363_RS03115 (ACB363_03115) | acrIIA3 | 598736..599110 (-) | 375 | WP_023611744.1 | anti-CRISPR protein AcrIIA3 | - |
| ACB363_RS03120 (ACB363_03120) | - | 599243..599599 (-) | 357 | WP_003055891.1 | hypothetical protein | - |
| ACB363_RS03125 (ACB363_03125) | - | 599601..600074 (-) | 474 | WP_076634523.1 | hypothetical protein | - |
| ACB363_RS03130 (ACB363_03130) | - | 600114..600353 (-) | 240 | WP_002986898.1 | hypothetical protein | - |
| ACB363_RS03135 (ACB363_03135) | prx | 600564..600746 (+) | 183 | WP_002986897.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6772.68 Da Isoelectric Point: 3.9286
>NTDB_id=1037911 ACB363_RS03135 WP_002986897.1 600564..600746(+) (prx) [Streptococcus pyogenes strain Isolate 5]
MLTYDEFKQAIDDGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDDGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1037911 ACB363_RS03135 WP_002986897.1 600564..600746(+) (prx) [Streptococcus pyogenes strain Isolate 5]
ATGCTAACATACGACGAGTTTAAGCAAGCAATCGATGACGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCAATCGATGACGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS8232 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |