Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB327_RS07090 | Genome accession | NZ_CP167020 |
| Coordinates | 1432212..1432391 (-) | Length | 59 a.a. |
| NCBI ID | WP_038432505.1 | Uniprot ID | A0A8B6IX98 |
| Organism | Streptococcus pyogenes strain Isolate 6 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1415202..1439940 | 1432212..1432391 | within | 0 |
Gene organization within MGE regions
Location: 1415202..1439940
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB327_RS07025 (ACB327_07025) | - | 1415202..1417655 (+) | 2454 | WP_076639282.1 | ATP-dependent RecD-like DNA helicase | - |
| ACB327_RS07030 (ACB327_07030) | - | 1417746..1418228 (+) | 483 | WP_076639283.1 | hypothetical protein | - |
| ACB327_RS07035 (ACB327_07035) | dinB | 1418321..1419415 (-) | 1095 | WP_020905451.1 | DNA polymerase IV | - |
| ACB327_RS07040 (ACB327_07040) | pflB | 1419624..1421951 (+) | 2328 | WP_021775477.1 | formate C-acetyltransferase | - |
| ACB327_RS07045 (ACB327_07045) | - | 1422131..1423081 (-) | 951 | WP_011018196.1 | serine hydrolase domain-containing protein | - |
| ACB327_RS07050 (ACB327_07050) | - | 1423066..1423818 (-) | 753 | WP_030126912.1 | CppA N-terminal domain-containing protein | - |
| ACB327_RS07055 (ACB327_07055) | - | 1424116..1425012 (+) | 897 | WP_174539214.1 | sulfite exporter TauE/SafE family protein | - |
| ACB327_RS07060 (ACB327_07060) | gla | 1425348..1426196 (-) | 849 | WP_002983047.1 | aquaglyceroporin Gla | - |
| ACB327_RS07065 (ACB327_07065) | - | 1426698..1427894 (-) | 1197 | WP_021775466.1 | MFS transporter | - |
| ACB327_RS07070 (ACB327_07070) | - | 1428060..1428719 (+) | 660 | WP_014635687.1 | Crp/Fnr family transcriptional regulator | - |
| ACB327_RS07075 (ACB327_07075) | - | 1428741..1431023 (+) | 2283 | WP_014411896.1 | Xaa-Pro dipeptidyl-peptidase | - |
| ACB327_RS07080 (ACB327_07080) | - | 1431103..1431324 (-) | 222 | WP_002988211.1 | helix-turn-helix domain-containing protein | - |
| ACB327_RS07085 (ACB327_07085) | - | 1431493..1431867 (+) | 375 | WP_002988207.1 | helix-turn-helix domain-containing protein | - |
| ACB327_RS07090 (ACB327_07090) | prx | 1432212..1432391 (-) | 180 | WP_038432505.1 | hypothetical protein | Regulator |
| ACB327_RS07095 (ACB327_07095) | sda3 | 1432630..1433430 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| ACB327_RS07100 (ACB327_07100) | - | 1433810..1434136 (+) | 327 | WP_012560945.1 | hypothetical protein | - |
| ACB327_RS07105 (ACB327_07105) | - | 1434186..1435052 (-) | 867 | WP_011888701.1 | DUF334 domain-containing protein | - |
| ACB327_RS07110 (ACB327_07110) | - | 1435040..1435564 (-) | 525 | WP_012560947.1 | Panacea domain-containing protein | - |
| ACB327_RS07115 (ACB327_07115) | - | 1435704..1436912 (-) | 1209 | WP_012560948.1 | glucosaminidase domain-containing protein | - |
| ACB327_RS07120 (ACB327_07120) | - | 1437028..1437213 (-) | 186 | WP_129322762.1 | phage holin | - |
| ACB327_RS07125 (ACB327_07125) | - | 1437225..1437710 (-) | 486 | Protein_1348 | hypothetical protein | - |
| ACB327_RS07130 (ACB327_07130) | - | 1437884..1438414 (+) | 531 | WP_161237452.1 | DUF536 domain-containing protein | - |
| ACB327_RS07135 (ACB327_07135) | - | 1438463..1439050 (+) | 588 | WP_011018202.1 | 3'-5' exonuclease | - |
| ACB327_RS07140 (ACB327_07140) | - | 1439203..1439940 (+) | 738 | WP_002982961.1 | MerR family transcriptional regulator | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6792.86 Da Isoelectric Point: 4.0650
>NTDB_id=1037876 ACB327_RS07090 WP_038432505.1 1432212..1432391(-) (prx) [Streptococcus pyogenes strain Isolate 6]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPGEPVRPWEVMTVEVAGEVLMELR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPGEPVRPWEVMTVEVAGEVLMELR
Nucleotide
Download Length: 180 bp
>NTDB_id=1037876 ACB327_RS07090 WP_038432505.1 1432212..1432391(-) (prx) [Streptococcus pyogenes strain Isolate 6]
ATGCTAACATACGACGAGTTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCCGGTGAGCCTGTGAGACCGTGGGAGGTTATGACAGTTGAAGTAGCGGGAGAAG
TGCTAATGGAATTGAGGTGA
ATGCTAACATACGACGAGTTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCCGGTGAGCCTGTGAGACCGTGGGAGGTTATGACAGTTGAAGTAGCGGGAGAAG
TGCTAATGGAATTGAGGTGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS8232 |
74.138 |
98.305 |
0.729 |
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
98.305 |
0.729 |
| prx | Streptococcus pyogenes MGAS315 |
90.476 |
71.186 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
69.492 |
0.593 |
| prx | Streptococcus pyogenes MGAS315 |
75.61 |
69.492 |
0.525 |