Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB327_RS04940 | Genome accession | NZ_CP167020 |
| Coordinates | 979764..979952 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain Isolate 6 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 972176..992291 | 979764..979952 | within | 0 |
Gene organization within MGE regions
Location: 972176..992291
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB327_RS04905 (ACB327_04905) | pfkA | 972176..973189 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| ACB327_RS04910 (ACB327_04910) | - | 973269..976379 (-) | 3111 | WP_031488246.1 | DNA polymerase III subunit alpha | - |
| ACB327_RS04915 (ACB327_04915) | - | 976564..976935 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| ACB327_RS04920 (ACB327_04920) | - | 976935..977633 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ACB327_RS04925 (ACB327_04925) | - | 977643..978428 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| ACB327_RS04930 (ACB327_04930) | - | 978559..979173 (-) | 615 | WP_129322707.1 | TVP38/TMEM64 family protein | - |
| ACB327_RS04940 (ACB327_04940) | prx | 979764..979952 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| ACB327_RS04945 (ACB327_04945) | spel | 980067..980855 (-) | 789 | WP_021340779.1 | streptococcal pyrogenic exotoxin SpeL | - |
| ACB327_RS04950 (ACB327_04950) | spem | 981137..981817 (-) | 681 | WP_371400114.1 | streptococcal pyrogenic exotoxin SpeM | - |
| ACB327_RS04955 (ACB327_04955) | - | 981786..982310 (-) | 525 | WP_129322709.1 | Panacea domain-containing protein | - |
| ACB327_RS04960 (ACB327_04960) | - | 982449..983657 (-) | 1209 | WP_012560948.1 | glucosaminidase domain-containing protein | - |
| ACB327_RS04965 (ACB327_04965) | - | 983773..985140 (-) | 1368 | WP_371400051.1 | terminase large subunit domain-containing protein | - |
| ACB327_RS04970 (ACB327_04970) | - | 985155..985622 (-) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| ACB327_RS04975 (ACB327_04975) | - | 985791..986132 (-) | 342 | WP_029714359.1 | HNH endonuclease | - |
| ACB327_RS04980 (ACB327_04980) | - | 986368..986553 (+) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| ACB327_RS04985 (ACB327_04985) | - | 986605..986982 (+) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| ACB327_RS04990 (ACB327_04990) | - | 987277..987510 (+) | 234 | WP_002995461.1 | hypothetical protein | - |
| ACB327_RS04995 (ACB327_04995) | - | 987600..988514 (-) | 915 | WP_011284864.1 | hypothetical protein | - |
| ACB327_RS05000 (ACB327_05000) | - | 989286..989726 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB327_RS05005 (ACB327_05005) | - | 989999..990634 (-) | 636 | WP_021340848.1 | N-6 DNA methylase | - |
| ACB327_RS05010 (ACB327_05010) | - | 990736..991308 (+) | 573 | Protein_939 | site-specific integrase | - |
| ACB327_RS05015 (ACB327_05015) | - | 991671..992291 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=1037865 ACB327_RS04940 WP_011054546.1 979764..979952(-) (prx) [Streptococcus pyogenes strain Isolate 6]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1037865 ACB327_RS04940 WP_011054546.1 979764..979952(-) (prx) [Streptococcus pyogenes strain Isolate 6]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |