Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB344_RS04335 | Genome accession | NZ_CP167018 |
| Coordinates | 831358..831546 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain Isolate 8 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 809569..839939 | 831358..831546 | within | 0 |
Gene organization within MGE regions
Location: 809569..839939
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB344_RS04185 (ACB344_04185) | - | 809569..810162 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| ACB344_RS04190 (ACB344_04190) | rfbB | 810406..811446 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| ACB344_RS04195 (ACB344_04195) | - | 811564..812463 (-) | 900 | WP_371400044.1 | tyrosine-type recombinase/integrase | - |
| ACB344_RS04200 (ACB344_04200) | - | 812610..812930 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| ACB344_RS04205 (ACB344_04205) | - | 812914..813270 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| ACB344_RS04210 (ACB344_04210) | - | 813267..813518 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| ACB344_RS04215 (ACB344_04215) | - | 813527..813736 (+) | 210 | Protein_781 | DUF4355 domain-containing protein | - |
| ACB344_RS04220 (ACB344_04220) | - | 813755..814645 (+) | 891 | WP_011528556.1 | hypothetical protein | - |
| ACB344_RS04225 (ACB344_04225) | - | 814657..814950 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| ACB344_RS04230 (ACB344_04230) | - | 814964..815308 (+) | 345 | WP_060388512.1 | hypothetical protein | - |
| ACB344_RS04235 (ACB344_04235) | - | 815305..815616 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| ACB344_RS04240 (ACB344_04240) | - | 815613..816008 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| ACB344_RS04245 (ACB344_04245) | - | 816010..816420 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| ACB344_RS04250 (ACB344_04250) | - | 816435..816689 (+) | 255 | WP_231494232.1 | phage major tail protein, TP901-1 family | - |
| ACB344_RS04255 (ACB344_04255) | - | 816702..816992 (+) | 291 | WP_060388513.1 | hypothetical protein | - |
| ACB344_RS04260 (ACB344_04260) | - | 816949..818526 (+) | 1578 | WP_231494234.1 | phage tail protein | - |
| ACB344_RS04265 (ACB344_04265) | - | 818527..820011 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| ACB344_RS04270 (ACB344_04270) | - | 820012..823461 (+) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| ACB344_RS04275 (ACB344_04275) | - | 823466..825328 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| ACB344_RS04280 (ACB344_04280) | - | 825339..825686 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| ACB344_RS04285 (ACB344_04285) | - | 825700..825822 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| ACB344_RS04290 (ACB344_04290) | - | 825836..826159 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| ACB344_RS04295 (ACB344_04295) | - | 826159..826491 (+) | 333 | WP_011054798.1 | phage holin | - |
| ACB344_RS04300 (ACB344_04300) | - | 826493..827257 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| ACB344_RS04305 (ACB344_04305) | - | 827269..827871 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| ACB344_RS04310 (ACB344_04310) | - | 827882..828655 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| ACB344_RS04315 (ACB344_04315) | - | 828665..828886 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| ACB344_RS04320 (ACB344_04320) | - | 828886..829545 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| ACB344_RS04325 (ACB344_04325) | - | 829614..830048 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| ACB344_RS04330 (ACB344_04330) | sda3 | 830320..831120 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| ACB344_RS04335 (ACB344_04335) | prx | 831358..831546 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| ACB344_RS04340 (ACB344_04340) | - | 831954..832430 (+) | 477 | WP_002984880.1 | 8-oxo-dGTP diphosphatase | - |
| ACB344_RS04345 (ACB344_04345) | - | 832488..833669 (+) | 1182 | WP_002984879.1 | AI-2E family transporter | - |
| ACB344_RS04350 (ACB344_04350) | - | 833659..834906 (+) | 1248 | WP_002984878.1 | tetratricopeptide repeat protein | - |
| ACB344_RS04355 (ACB344_04355) | fbp54 | 834965..836617 (-) | 1653 | WP_021299312.1 | Rqc2 family fibronectin-binding protein Fbp54 | - |
| ACB344_RS04360 (ACB344_04360) | trpX | 836971..837969 (+) | 999 | WP_011184452.1 | tryptophan ABC transporter substrate-binding protein | - |
| ACB344_RS04365 (ACB344_04365) | - | 838315..839184 (+) | 870 | WP_011017706.1 | ABC transporter permease | - |
| ACB344_RS04370 (ACB344_04370) | - | 839181..839939 (+) | 759 | WP_011017707.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=1037755 ACB344_RS04335 WP_011528571.1 831358..831546(+) (prx) [Streptococcus pyogenes strain Isolate 8]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=1037755 ACB344_RS04335 WP_011528571.1 831358..831546(+) (prx) [Streptococcus pyogenes strain Isolate 8]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |