Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB337_RS07180 | Genome accession | NZ_CP167017 |
| Coordinates | 1409923..1410102 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain Isolate 9 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1409923..1450539 | 1409923..1410102 | within | 0 |
Gene organization within MGE regions
Location: 1409923..1450539
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB337_RS07180 (ACB337_07185) | prx | 1409923..1410102 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ACB337_RS07185 (ACB337_07190) | sda1 | 1410341..1411513 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ACB337_RS07190 (ACB337_07195) | - | 1411629..1412825 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ACB337_RS07195 (ACB337_07200) | - | 1412936..1413121 (-) | 186 | WP_002988802.1 | holin | - |
| ACB337_RS07200 (ACB337_07205) | - | 1413118..1413417 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ACB337_RS07205 (ACB337_07210) | - | 1413428..1414048 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ACB337_RS07210 (ACB337_07215) | - | 1414051..1414212 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ACB337_RS07215 (ACB337_07220) | - | 1414221..1416128 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| ACB337_RS07220 (ACB337_07225) | - | 1416139..1416774 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| ACB337_RS07225 (ACB337_07230) | - | 1416774..1417829 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ACB337_RS07230 (ACB337_07235) | - | 1417826..1419808 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ACB337_RS07235 (ACB337_07240) | - | 1419818..1420660 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ACB337_RS07240 (ACB337_07245) | - | 1420672..1425054 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ACB337_RS07245 (ACB337_07250) | - | 1425069..1425302 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ACB337_RS07250 (ACB337_07255) | - | 1425377..1425832 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ACB337_RS07255 (ACB337_07260) | - | 1425886..1426485 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ACB337_RS07260 (ACB337_07265) | - | 1426497..1426856 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| ACB337_RS07265 (ACB337_07270) | - | 1426860..1427204 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACB337_RS07270 (ACB337_07275) | - | 1427201..1427479 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ACB337_RS07275 (ACB337_07280) | - | 1427490..1427846 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ACB337_RS07280 (ACB337_07285) | - | 1427858..1428745 (-) | 888 | WP_322794628.1 | phage capsid protein | - |
| ACB337_RS07285 (ACB337_07290) | - | 1428758..1429327 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ACB337_RS07290 (ACB337_07295) | - | 1429483..1429749 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ACB337_RS07295 (ACB337_07300) | - | 1429752..1429940 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ACB337_RS07300 (ACB337_07305) | - | 1429971..1431416 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ACB337_RS07305 (ACB337_07310) | - | 1431376..1432908 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| ACB337_RS07310 (ACB337_07315) | - | 1432924..1434201 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ACB337_RS07315 (ACB337_07320) | - | 1434191..1434643 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ACB337_RS07320 (ACB337_07325) | - | 1434733..1435149 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ACB337_RS07325 (ACB337_07330) | - | 1435146..1435337 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ACB337_RS07330 (ACB337_07335) | - | 1435327..1436178 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| ACB337_RS07335 (ACB337_07340) | - | 1436187..1436453 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ACB337_RS07340 (ACB337_07345) | - | 1436450..1436617 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ACB337_RS07345 (ACB337_07350) | - | 1436618..1437940 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ACB337_RS07350 (ACB337_07355) | - | 1437937..1438212 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ACB337_RS07355 (ACB337_07360) | - | 1438599..1440983 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| ACB337_RS07360 (ACB337_07365) | - | 1440988..1442910 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ACB337_RS07365 (ACB337_07370) | - | 1442953..1443510 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ACB337_RS07370 (ACB337_07375) | - | 1443521..1443919 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ACB337_RS07375 (ACB337_07380) | - | 1443923..1445077 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ACB337_RS07380 (ACB337_07385) | - | 1445077..1445376 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ACB337_RS07385 (ACB337_07390) | - | 1445464..1445667 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ACB337_RS07390 (ACB337_07395) | - | 1445813..1446199 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ACB337_RS07395 (ACB337_07400) | - | 1446196..1446399 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ACB337_RS07400 (ACB337_07405) | - | 1446392..1446562 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ACB337_RS07405 (ACB337_07410) | - | 1446559..1446834 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ACB337_RS07410 (ACB337_07415) | - | 1446896..1447111 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ACB337_RS07415 (ACB337_07420) | - | 1447159..1447572 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ACB337_RS07420 (ACB337_07425) | - | 1447553..1447708 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ACB337_RS07425 (ACB337_07430) | - | 1448034..1448384 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| ACB337_RS07430 (ACB337_07435) | - | 1448398..1448781 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB337_RS07435 (ACB337_07440) | - | 1448792..1449343 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ACB337_RS07440 (ACB337_07445) | - | 1449460..1450539 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=1037705 ACB337_RS07180 WP_002988813.1 1409923..1410102(-) (prx) [Streptococcus pyogenes strain Isolate 9]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1037705 ACB337_RS07180 WP_002988813.1 1409923..1410102(-) (prx) [Streptococcus pyogenes strain Isolate 9]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |