Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB337_RS05910 | Genome accession | NZ_CP167017 |
| Coordinates | 1170246..1170428 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 9 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1170246..1205256 | 1170246..1170428 | within | 0 |
Gene organization within MGE regions
Location: 1170246..1205256
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB337_RS05910 (ACB337_05915) | prx | 1170246..1170428 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| ACB337_RS05915 (ACB337_05920) | sda3 | 1170667..1171467 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| ACB337_RS05920 (ACB337_05925) | - | 1171738..1172172 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| ACB337_RS05925 (ACB337_05930) | - | 1172242..1173447 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| ACB337_RS05930 (ACB337_05935) | - | 1173563..1173790 (-) | 228 | WP_003058873.1 | phage holin | - |
| ACB337_RS05935 (ACB337_05940) | - | 1173787..1174062 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| ACB337_RS05940 (ACB337_05945) | - | 1174072..1174689 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| ACB337_RS05945 (ACB337_05950) | - | 1174686..1175123 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| ACB337_RS05950 (ACB337_05955) | - | 1175135..1177003 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| ACB337_RS05955 (ACB337_05960) | - | 1177000..1177695 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| ACB337_RS05960 (ACB337_05965) | - | 1177692..1180049 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| ACB337_RS05965 (ACB337_05970) | - | 1180049..1180420 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| ACB337_RS05970 (ACB337_05975) | - | 1180435..1180698 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| ACB337_RS05975 (ACB337_05980) | - | 1180709..1181302 (-) | 594 | WP_010922456.1 | tail protein | - |
| ACB337_RS05980 (ACB337_05985) | - | 1181314..1181649 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| ACB337_RS05985 (ACB337_05990) | - | 1181650..1181886 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| ACB337_RS05990 (ACB337_05995) | - | 1181879..1182217 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| ACB337_RS05995 (ACB337_06000) | - | 1182177..1182599 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ACB337_RS06000 (ACB337_06005) | - | 1182609..1182809 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| ACB337_RS06005 (ACB337_06010) | - | 1182809..1183720 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| ACB337_RS06010 (ACB337_06015) | - | 1183745..1184206 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| ACB337_RS06015 (ACB337_06020) | - | 1184287..1185702 (-) | 1416 | WP_011285619.1 | terminase | - |
| ACB337_RS06020 (ACB337_06025) | - | 1185812..1186078 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| ACB337_RS06025 (ACB337_06030) | - | 1186071..1186250 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| ACB337_RS06030 (ACB337_06035) | - | 1186300..1186524 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| ACB337_RS06035 (ACB337_06040) | - | 1186530..1188023 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| ACB337_RS06040 (ACB337_06045) | - | 1188016..1189284 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| ACB337_RS06045 (ACB337_06050) | - | 1189281..1189637 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| ACB337_RS06050 (ACB337_06055) | - | 1189786..1190130 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| ACB337_RS06055 (ACB337_06060) | - | 1190239..1190658 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| ACB337_RS06060 (ACB337_06065) | - | 1190926..1191561 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| ACB337_RS06065 (ACB337_06070) | - | 1191563..1191832 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| ACB337_RS06070 (ACB337_06075) | - | 1191916..1192428 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| ACB337_RS06075 (ACB337_06080) | - | 1192425..1192766 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| ACB337_RS06080 (ACB337_06085) | - | 1192944..1193111 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| ACB337_RS06085 (ACB337_06090) | - | 1193121..1193918 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACB337_RS06090 (ACB337_06095) | - | 1193915..1194844 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| ACB337_RS06095 (ACB337_06100) | - | 1194847..1195176 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| ACB337_RS06100 (ACB337_06105) | - | 1195232..1195438 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| ACB337_RS06105 (ACB337_06110) | - | 1195447..1195587 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| ACB337_RS06110 (ACB337_06115) | - | 1195584..1195817 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| ACB337_RS06115 (ACB337_06120) | - | 1195798..1196187 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| ACB337_RS06120 (ACB337_06125) | - | 1196332..1196571 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| ACB337_RS06125 (ACB337_06130) | - | 1196671..1196856 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| ACB337_RS06130 (ACB337_06135) | - | 1196858..1197169 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| ACB337_RS06135 (ACB337_06140) | - | 1197247..1197432 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| ACB337_RS06140 (ACB337_06145) | - | 1197599..1197838 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| ACB337_RS06145 (ACB337_06150) | - | 1197980..1198786 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| ACB337_RS06150 (ACB337_06155) | - | 1198721..1198987 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| ACB337_RS06155 (ACB337_06160) | - | 1199019..1199735 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| ACB337_RS06160 (ACB337_06165) | - | 1199747..1199938 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| ACB337_RS06165 (ACB337_06170) | - | 1200574..1200669 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| ACB337_RS06170 (ACB337_06175) | - | 1201092..1201439 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| ACB337_RS06175 (ACB337_06180) | - | 1201443..1201823 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB337_RS06180 (ACB337_06185) | - | 1201835..1202101 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| ACB337_RS06185 (ACB337_06190) | - | 1202225..1203367 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ACB337_RS06190 (ACB337_06195) | - | 1203457..1203732 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ACB337_RS06195 (ACB337_06200) | - | 1203831..1204418 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| ACB337_RS06200 (ACB337_06205) | - | 1204396..1205238 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1037698 ACB337_RS05910 WP_011017964.1 1170246..1170428(-) (prx) [Streptococcus pyogenes strain Isolate 9]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1037698 ACB337_RS05910 WP_011017964.1 1170246..1170428(-) (prx) [Streptococcus pyogenes strain Isolate 9]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |