Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB337_RS05065 | Genome accession | NZ_CP167017 |
| Coordinates | 1008505..1008693 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 9 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1000921..1047231 | 1008505..1008693 | within | 0 |
Gene organization within MGE regions
Location: 1000921..1047231
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB337_RS05030 (ACB337_05035) | pfkA | 1000921..1001934 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| ACB337_RS05035 (ACB337_05040) | - | 1002014..1005124 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| ACB337_RS05040 (ACB337_05045) | - | 1005309..1005680 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| ACB337_RS05045 (ACB337_05050) | - | 1005680..1006378 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ACB337_RS05050 (ACB337_05055) | - | 1006388..1007173 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| ACB337_RS05055 (ACB337_05060) | - | 1007300..1007914 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| ACB337_RS05065 (ACB337_05070) | prx | 1008505..1008693 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| ACB337_RS05070 (ACB337_05075) | speA | 1008913..1009668 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| ACB337_RS05075 (ACB337_05080) | - | 1009790..1010449 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| ACB337_RS05080 (ACB337_05085) | - | 1010449..1010670 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| ACB337_RS05085 (ACB337_05090) | - | 1010680..1011453 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| ACB337_RS05090 (ACB337_05095) | - | 1011464..1012066 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| ACB337_RS05095 (ACB337_05100) | - | 1012078..1012842 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| ACB337_RS05100 (ACB337_05105) | - | 1012844..1013176 (-) | 333 | WP_011285562.1 | phage holin | - |
| ACB337_RS05105 (ACB337_05110) | - | 1013176..1013499 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| ACB337_RS05110 (ACB337_05115) | - | 1013513..1013635 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| ACB337_RS05115 (ACB337_05120) | - | 1013649..1013996 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| ACB337_RS05120 (ACB337_05125) | - | 1014007..1015869 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| ACB337_RS05125 (ACB337_05130) | - | 1015874..1019314 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| ACB337_RS05130 (ACB337_05135) | - | 1019315..1020799 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| ACB337_RS05135 (ACB337_05140) | - | 1020800..1022605 (-) | 1806 | WP_011054802.1 | tail protein | - |
| ACB337_RS05140 (ACB337_05145) | - | 1022598..1023056 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| ACB337_RS05145 (ACB337_05150) | - | 1023029..1023346 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| ACB337_RS05150 (ACB337_05155) | - | 1023359..1023865 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| ACB337_RS05155 (ACB337_05160) | - | 1023877..1024287 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| ACB337_RS05160 (ACB337_05165) | - | 1024289..1024684 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| ACB337_RS05165 (ACB337_05170) | - | 1024681..1024992 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| ACB337_RS05170 (ACB337_05175) | - | 1024989..1025333 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| ACB337_RS05175 (ACB337_05180) | - | 1025347..1025640 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| ACB337_RS05180 (ACB337_05185) | - | 1025653..1026543 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| ACB337_RS05185 (ACB337_05190) | - | 1026562..1027131 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| ACB337_RS05190 (ACB337_05195) | - | 1027240..1027374 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| ACB337_RS05195 (ACB337_05200) | - | 1027376..1027645 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| ACB337_RS05200 (ACB337_05205) | - | 1027652..1028560 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| ACB337_RS05205 (ACB337_05210) | - | 1028529..1029854 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| ACB337_RS05210 (ACB337_05215) | - | 1029854..1031128 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| ACB337_RS05215 (ACB337_05220) | - | 1031118..1031498 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| ACB337_RS05220 (ACB337_05225) | - | 1032108..1032542 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB337_RS05225 (ACB337_05230) | - | 1032828..1033094 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| ACB337_RS05230 (ACB337_05235) | - | 1033091..1033615 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| ACB337_RS05235 (ACB337_05240) | - | 1033618..1034250 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ACB337_RS05240 (ACB337_05245) | - | 1034252..1034536 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| ACB337_RS05245 (ACB337_05250) | - | 1034533..1034703 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| ACB337_RS05250 (ACB337_05255) | - | 1034700..1034936 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| ACB337_RS05255 (ACB337_05260) | - | 1034936..1035181 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| ACB337_RS05260 (ACB337_05265) | - | 1035178..1035534 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| ACB337_RS05265 (ACB337_05270) | - | 1035531..1035971 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACB337_RS05270 (ACB337_05275) | - | 1035971..1036174 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| ACB337_RS05275 (ACB337_05280) | ssb | 1036180..1036605 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| ACB337_RS05280 (ACB337_05285) | - | 1036598..1037272 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| ACB337_RS05285 (ACB337_05290) | - | 1037273..1037755 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| ACB337_RS05290 (ACB337_05295) | - | 1037777..1038031 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| ACB337_RS05295 (ACB337_05300) | - | 1038012..1038365 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| ACB337_RS05300 (ACB337_05305) | - | 1038506..1039288 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| ACB337_RS05305 (ACB337_05310) | - | 1039275..1040105 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACB337_RS05310 (ACB337_05315) | - | 1040119..1040307 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| ACB337_RS05315 (ACB337_05320) | - | 1040541..1040780 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| ACB337_RS05320 (ACB337_05325) | - | 1040911..1041120 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| ACB337_RS05325 (ACB337_05330) | - | 1041230..1041430 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| ACB337_RS05330 (ACB337_05335) | - | 1041504..1041890 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| ACB337_RS05335 (ACB337_05340) | - | 1041879..1042088 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| ACB337_RS05340 (ACB337_05345) | - | 1042142..1042741 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| ACB337_RS05345 (ACB337_05350) | - | 1042771..1042929 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| ACB337_RS05350 (ACB337_05355) | - | 1043286..1044110 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| ACB337_RS05355 (ACB337_05360) | - | 1044146..1045039 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| ACB337_RS05360 (ACB337_05365) | - | 1045160..1046248 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| ACB337_RS05365 (ACB337_05370) | - | 1046611..1047231 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=1037694 ACB337_RS05065 WP_011285559.1 1008505..1008693(-) (prx) [Streptococcus pyogenes strain Isolate 9]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1037694 ACB337_RS05065 WP_011285559.1 1008505..1008693(-) (prx) [Streptococcus pyogenes strain Isolate 9]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |