Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB332_RS05600 | Genome accession | NZ_CP167016 |
| Coordinates | 1120831..1121013 (-) | Length | 60 a.a. |
| NCBI ID | WP_129322727.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 10 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1120831..1137652 | 1120831..1121013 | within | 0 |
Gene organization within MGE regions
Location: 1120831..1137652
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB332_RS05600 (ACB332_05600) | prx | 1120831..1121013 (-) | 183 | WP_129322727.1 | Paratox | Regulator |
| ACB332_RS05605 (ACB332_05605) | mf2 | 1121253..1122011 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| ACB332_RS05610 (ACB332_05610) | speC | 1122122..1122829 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| ACB332_RS05615 (ACB332_05615) | - | 1122905..1124239 (-) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| ACB332_RS05620 (ACB332_05620) | - | 1124351..1124764 (-) | 414 | WP_161237426.1 | DUF1366 domain-containing protein | - |
| ACB332_RS05625 (ACB332_05625) | - | 1124767..1125195 (-) | 429 | WP_115219682.1 | DUF1617 family protein | - |
| ACB332_RS05630 (ACB332_05630) | - | 1125207..1127093 (-) | 1887 | WP_129322729.1 | gp58-like family protein | - |
| ACB332_RS05635 (ACB332_05635) | - | 1127104..1127418 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| ACB332_RS05640 (ACB332_05640) | - | 1127420..1128148 (-) | 729 | WP_129322730.1 | hypothetical protein | - |
| ACB332_RS05645 (ACB332_05645) | - | 1128145..1128420 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| ACB332_RS05650 (ACB332_05650) | - | 1128806..1131190 (-) | 2385 | WP_111688312.1 | phage/plasmid primase, P4 family | - |
| ACB332_RS05655 (ACB332_05655) | - | 1131195..1132940 (-) | 1746 | Protein_1068 | DNA polymerase | - |
| ACB332_RS05660 (ACB332_05660) | - | 1133170..1133430 (+) | 261 | WP_023611024.1 | hypothetical protein | - |
| ACB332_RS05665 (ACB332_05665) | - | 1133529..1134266 (-) | 738 | WP_023611022.1 | phage antirepressor KilAC domain-containing protein | - |
| ACB332_RS05670 (ACB332_05670) | - | 1134278..1134469 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| ACB332_RS05675 (ACB332_05675) | - | 1135105..1135200 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| ACB332_RS05680 (ACB332_05680) | - | 1135623..1135970 (+) | 348 | WP_002994741.1 | helix-turn-helix domain-containing protein | - |
| ACB332_RS05685 (ACB332_05685) | - | 1135974..1136354 (+) | 381 | WP_371400054.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB332_RS05690 (ACB332_05690) | - | 1136366..1136527 (+) | 162 | Protein_1075 | DUF4177 domain-containing protein | - |
| ACB332_RS05695 (ACB332_05695) | - | 1136524..1137288 (+) | 765 | Protein_1076 | tyrosine-type recombinase/integrase | - |
| ACB332_RS05700 (ACB332_05700) | - | 1137377..1137652 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6959.93 Da Isoelectric Point: 4.1954
>NTDB_id=1037648 ACB332_RS05600 WP_129322727.1 1120831..1121013(-) (prx) [Streptococcus pyogenes strain Isolate 10]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1037648 ACB332_RS05600 WP_129322727.1 1120831..1121013(-) (prx) [Streptococcus pyogenes strain Isolate 10]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTAGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTAGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
70 |
0.667 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
68.333 |
0.55 |