Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB332_RS04940 | Genome accession | NZ_CP167016 |
| Coordinates | 979812..980000 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain Isolate 10 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 972224..992339 | 979812..980000 | within | 0 |
Gene organization within MGE regions
Location: 972224..992339
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB332_RS04905 (ACB332_04905) | pfkA | 972224..973237 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| ACB332_RS04910 (ACB332_04910) | - | 973317..976427 (-) | 3111 | WP_031488246.1 | DNA polymerase III subunit alpha | - |
| ACB332_RS04915 (ACB332_04915) | - | 976612..976983 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| ACB332_RS04920 (ACB332_04920) | - | 976983..977681 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ACB332_RS04925 (ACB332_04925) | - | 977691..978476 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| ACB332_RS04930 (ACB332_04930) | - | 978607..979221 (-) | 615 | WP_129322707.1 | TVP38/TMEM64 family protein | - |
| ACB332_RS04940 (ACB332_04940) | prx | 979812..980000 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| ACB332_RS04945 (ACB332_04945) | spel | 980115..980903 (-) | 789 | WP_021340779.1 | streptococcal pyrogenic exotoxin SpeL | - |
| ACB332_RS04950 (ACB332_04950) | spem | 981185..981865 (-) | 681 | WP_129322708.1 | streptococcal pyrogenic exotoxin SpeM | - |
| ACB332_RS04955 (ACB332_04955) | - | 981834..982358 (-) | 525 | WP_129322709.1 | Panacea domain-containing protein | - |
| ACB332_RS04960 (ACB332_04960) | - | 982497..983705 (-) | 1209 | WP_012560948.1 | glucosaminidase domain-containing protein | - |
| ACB332_RS04965 (ACB332_04965) | - | 983821..985188 (-) | 1368 | WP_371400051.1 | terminase large subunit domain-containing protein | - |
| ACB332_RS04970 (ACB332_04970) | - | 985203..985670 (-) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| ACB332_RS04975 (ACB332_04975) | - | 985839..986180 (-) | 342 | WP_029714359.1 | HNH endonuclease | - |
| ACB332_RS04980 (ACB332_04980) | - | 986416..986601 (+) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| ACB332_RS04985 (ACB332_04985) | - | 986653..987030 (+) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| ACB332_RS04990 (ACB332_04990) | - | 987325..987558 (+) | 234 | WP_002995461.1 | hypothetical protein | - |
| ACB332_RS04995 (ACB332_04995) | - | 987648..988562 (-) | 915 | WP_011284864.1 | hypothetical protein | - |
| ACB332_RS05000 (ACB332_05000) | - | 989334..989774 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB332_RS05005 (ACB332_05005) | - | 990047..990682 (-) | 636 | WP_021340848.1 | N-6 DNA methylase | - |
| ACB332_RS05010 (ACB332_05010) | - | 990784..991356 (+) | 573 | Protein_939 | site-specific integrase | - |
| ACB332_RS05015 (ACB332_05015) | - | 991719..992339 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=1037645 ACB332_RS04940 WP_011054546.1 979812..980000(-) (prx) [Streptococcus pyogenes strain Isolate 10]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1037645 ACB332_RS04940 WP_011054546.1 979812..980000(-) (prx) [Streptococcus pyogenes strain Isolate 10]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |