Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB351_RS04910 | Genome accession | NZ_CP167015 |
| Coordinates | 985822..986010 (-) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 11 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 978238..1032764 | 985822..986010 | within | 0 |
Gene organization within MGE regions
Location: 978238..1032764
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB351_RS04875 (ACB351_04875) | pfkA | 978238..979251 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| ACB351_RS04880 (ACB351_04880) | - | 979331..982441 (-) | 3111 | WP_011284836.1 | DNA polymerase III subunit alpha | - |
| ACB351_RS04885 (ACB351_04885) | - | 982626..982997 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| ACB351_RS04890 (ACB351_04890) | - | 982997..983695 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ACB351_RS04895 (ACB351_04895) | - | 983705..984490 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| ACB351_RS04900 (ACB351_04900) | - | 984617..985231 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| ACB351_RS04910 (ACB351_04910) | prx | 985822..986010 (-) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| ACB351_RS04915 (ACB351_04915) | mf2 | 986250..987008 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| ACB351_RS04920 (ACB351_04920) | speC | 987119..987826 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| ACB351_RS04925 (ACB351_04925) | - | 987902..989236 (-) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| ACB351_RS04930 (ACB351_04930) | - | 989348..989533 (-) | 186 | WP_011284839.1 | holin | - |
| ACB351_RS04935 (ACB351_04935) | - | 989530..989826 (-) | 297 | WP_002990012.1 | hypothetical protein | - |
| ACB351_RS04940 (ACB351_04940) | - | 989837..990454 (-) | 618 | WP_011284840.1 | hypothetical protein | - |
| ACB351_RS04945 (ACB351_04945) | - | 990457..990618 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ACB351_RS04950 (ACB351_04950) | - | 990632..992527 (-) | 1896 | WP_371399926.1 | gp58-like family protein | - |
| ACB351_RS04955 (ACB351_04955) | - | 992538..992852 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| ACB351_RS04960 (ACB351_04960) | - | 992854..994068 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| ACB351_RS04965 (ACB351_04965) | - | 994065..996119 (-) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| ACB351_RS04970 (ACB351_04970) | - | 996116..996895 (-) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| ACB351_RS04975 (ACB351_04975) | - | 996927..1000562 (-) | 3636 | WP_011284846.1 | tape measure protein | - |
| ACB351_RS04980 (ACB351_04980) | - | 1000577..1000873 (-) | 297 | WP_021340179.1 | hypothetical protein | - |
| ACB351_RS04985 (ACB351_04985) | - | 1000948..1001301 (-) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| ACB351_RS04990 (ACB351_04990) | - | 1001355..1001978 (-) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| ACB351_RS04995 (ACB351_04995) | - | 1002033..1002422 (-) | 390 | WP_011284850.1 | hypothetical protein | - |
| ACB351_RS05000 (ACB351_05000) | - | 1002419..1002784 (-) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACB351_RS05005 (ACB351_05005) | - | 1002765..1003073 (-) | 309 | WP_011284852.1 | hypothetical protein | - |
| ACB351_RS05010 (ACB351_05010) | - | 1003070..1003423 (-) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| ACB351_RS05015 (ACB351_05015) | - | 1003437..1003679 (-) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| ACB351_RS05020 (ACB351_05020) | - | 1003689..1004771 (-) | 1083 | WP_011284855.1 | major capsid protein | - |
| ACB351_RS05025 (ACB351_05025) | - | 1004774..1005154 (-) | 381 | WP_011284856.1 | head decoration protein | - |
| ACB351_RS05030 (ACB351_05030) | - | 1005164..1005697 (-) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| ACB351_RS05035 (ACB351_05035) | - | 1005841..1006107 (-) | 267 | WP_011284858.1 | hypothetical protein | - |
| ACB351_RS05040 (ACB351_05040) | - | 1006110..1006424 (-) | 315 | WP_011284859.1 | hypothetical protein | - |
| ACB351_RS05045 (ACB351_05045) | - | 1006494..1006679 (-) | 186 | WP_002988389.1 | hypothetical protein | - |
| ACB351_RS05050 (ACB351_05050) | - | 1006683..1008245 (-) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| ACB351_RS05055 (ACB351_05055) | - | 1008226..1009728 (-) | 1503 | WP_002984369.1 | phage portal protein | - |
| ACB351_RS05060 (ACB351_05060) | - | 1009740..1011047 (-) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| ACB351_RS05065 (ACB351_05065) | - | 1011025..1011456 (-) | 432 | WP_023079766.1 | terminase small subunit | - |
| ACB351_RS05070 (ACB351_05070) | - | 1011555..1011740 (+) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| ACB351_RS05075 (ACB351_05075) | - | 1011792..1012169 (+) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| ACB351_RS05080 (ACB351_05080) | - | 1012464..1012697 (+) | 234 | WP_002995461.1 | hypothetical protein | - |
| ACB351_RS05085 (ACB351_05085) | - | 1012787..1013701 (-) | 915 | WP_011284864.1 | hypothetical protein | - |
| ACB351_RS05090 (ACB351_05090) | - | 1014279..1014713 (-) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB351_RS05095 (ACB351_05095) | - | 1015162..1015641 (-) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| ACB351_RS05100 (ACB351_05100) | - | 1015646..1016278 (-) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| ACB351_RS05105 (ACB351_05105) | - | 1016280..1016564 (-) | 285 | WP_011284869.1 | hypothetical protein | - |
| ACB351_RS05110 (ACB351_05110) | - | 1016561..1016731 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| ACB351_RS05115 (ACB351_05115) | - | 1016728..1016964 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| ACB351_RS05120 (ACB351_05120) | - | 1016964..1017209 (-) | 246 | WP_011284872.1 | hypothetical protein | - |
| ACB351_RS05125 (ACB351_05125) | - | 1017206..1017562 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| ACB351_RS05130 (ACB351_05130) | - | 1017546..1017830 (-) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| ACB351_RS05135 (ACB351_05135) | - | 1017850..1018719 (-) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| ACB351_RS05140 (ACB351_05140) | - | 1018988..1020541 (-) | 1554 | WP_011284875.1 | hypothetical protein | - |
| ACB351_RS05145 (ACB351_05145) | - | 1020559..1021041 (-) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| ACB351_RS05150 (ACB351_05150) | - | 1021046..1022470 (-) | 1425 | Protein_967 | DEAD/DEAH box helicase | - |
| ACB351_RS05155 (ACB351_05155) | - | 1022485..1023168 (-) | 684 | WP_002984321.1 | AAA family ATPase | - |
| ACB351_RS05160 (ACB351_05160) | - | 1023165..1023449 (-) | 285 | WP_011284877.1 | hypothetical protein | - |
| ACB351_RS05165 (ACB351_05165) | - | 1023446..1023640 (-) | 195 | WP_002984315.1 | hypothetical protein | - |
| ACB351_RS05170 (ACB351_05170) | - | 1023640..1023969 (-) | 330 | WP_011284878.1 | hypothetical protein | - |
| ACB351_RS05175 (ACB351_05175) | - | 1024050..1024187 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| ACB351_RS05180 (ACB351_05180) | - | 1024184..1024480 (-) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| ACB351_RS05185 (ACB351_05185) | - | 1024559..1024744 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| ACB351_RS05190 (ACB351_05190) | - | 1024911..1025150 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| ACB351_RS05195 (ACB351_05195) | - | 1025300..1025509 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| ACB351_RS05200 (ACB351_05200) | - | 1025768..1026277 (+) | 510 | WP_047298031.1 | hypothetical protein | - |
| ACB351_RS05205 (ACB351_05205) | - | 1026385..1026612 (-) | 228 | WP_002984281.1 | hypothetical protein | - |
| ACB351_RS05210 (ACB351_05210) | - | 1026686..1027072 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| ACB351_RS05215 (ACB351_05215) | - | 1027061..1027270 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| ACB351_RS05220 (ACB351_05220) | - | 1027324..1027923 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| ACB351_RS05225 (ACB351_05225) | - | 1027953..1028111 (-) | 159 | WP_011284883.1 | hypothetical protein | - |
| ACB351_RS05230 (ACB351_05230) | - | 1028170..1028385 (+) | 216 | WP_021341080.1 | hypothetical protein | - |
| ACB351_RS05235 (ACB351_05235) | - | 1028371..1028520 (-) | 150 | WP_021340643.1 | hypothetical protein | - |
| ACB351_RS05240 (ACB351_05240) | - | 1028878..1029621 (+) | 744 | WP_011284884.1 | XRE family transcriptional regulator | - |
| ACB351_RS05245 (ACB351_05245) | - | 1029634..1030443 (+) | 810 | WP_023079768.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| ACB351_RS05250 (ACB351_05250) | - | 1030693..1031781 (+) | 1089 | WP_023079773.1 | site-specific integrase | - |
| ACB351_RS05255 (ACB351_05255) | - | 1032144..1032764 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=1037588 ACB351_RS04910 WP_002993136.1 985822..986010(-) (prx) [Streptococcus pyogenes strain Isolate 11]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1037588 ACB351_RS04910 WP_002993136.1 985822..986010(-) (prx) [Streptococcus pyogenes strain Isolate 11]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |