Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB343_RS06175 | Genome accession | NZ_CP167012 |
| Coordinates | 1226522..1226704 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054726.1 | Uniprot ID | A0A5S4TS04 |
| Organism | Streptococcus pyogenes strain Isolate 17 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1226522..1268551 | 1226522..1226704 | within | 0 |
Gene organization within MGE regions
Location: 1226522..1268551
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB343_RS06175 (ACB343_06175) | prx | 1226522..1226704 (-) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
| ACB343_RS06180 (ACB343_06180) | - | 1227050..1227625 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| ACB343_RS06185 (ACB343_06185) | spek | 1228101..1228880 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| ACB343_RS06190 (ACB343_06190) | - | 1229183..1230049 (-) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| ACB343_RS06195 (ACB343_06195) | - | 1230037..1230561 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| ACB343_RS06200 (ACB343_06200) | - | 1230701..1231903 (-) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| ACB343_RS06205 (ACB343_06205) | - | 1232014..1232199 (-) | 186 | WP_011054731.1 | holin | - |
| ACB343_RS06210 (ACB343_06210) | - | 1232196..1232492 (-) | 297 | WP_011054732.1 | hypothetical protein | - |
| ACB343_RS06215 (ACB343_06215) | - | 1232503..1233114 (-) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| ACB343_RS06220 (ACB343_06220) | - | 1233117..1233548 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| ACB343_RS06225 (ACB343_06225) | - | 1233560..1235446 (-) | 1887 | WP_371400097.1 | gp58-like family protein | - |
| ACB343_RS06230 (ACB343_06230) | - | 1235457..1235771 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| ACB343_RS06235 (ACB343_06235) | - | 1235773..1236987 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| ACB343_RS06240 (ACB343_06240) | - | 1236984..1239131 (-) | 2148 | WP_047297976.1 | phage tail spike protein | - |
| ACB343_RS06245 (ACB343_06245) | - | 1239128..1239844 (-) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| ACB343_RS06250 (ACB343_06250) | - | 1239841..1243101 (-) | 3261 | WP_011054738.1 | tape measure protein | - |
| ACB343_RS06255 (ACB343_06255) | - | 1243091..1243672 (-) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| ACB343_RS06260 (ACB343_06260) | - | 1243676..1244110 (-) | 435 | WP_011054740.1 | hypothetical protein | - |
| ACB343_RS06265 (ACB343_06265) | - | 1244149..1244634 (-) | 486 | WP_011054741.1 | phage tail tube protein | - |
| ACB343_RS06270 (ACB343_06270) | - | 1244634..1245032 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| ACB343_RS06275 (ACB343_06275) | - | 1245029..1245385 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| ACB343_RS06280 (ACB343_06280) | - | 1245385..1245717 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| ACB343_RS06285 (ACB343_06285) | - | 1245707..1246123 (-) | 417 | WP_011054743.1 | hypothetical protein | - |
| ACB343_RS06290 (ACB343_06290) | - | 1246177..1246995 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| ACB343_RS06295 (ACB343_06295) | - | 1246999..1247613 (-) | 615 | WP_011106689.1 | hypothetical protein | - |
| ACB343_RS06300 (ACB343_06300) | - | 1247739..1248005 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| ACB343_RS06305 (ACB343_06305) | - | 1248067..1248306 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| ACB343_RS06310 (ACB343_06310) | - | 1248278..1249756 (-) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| ACB343_RS06315 (ACB343_06315) | - | 1249761..1251263 (-) | 1503 | WP_002986832.1 | phage portal protein | - |
| ACB343_RS06320 (ACB343_06320) | - | 1251277..1252532 (-) | 1256 | Protein_1201 | PBSX family phage terminase large subunit | - |
| ACB343_RS06325 (ACB343_06325) | - | 1252571..1253044 (-) | 474 | WP_011054747.1 | hypothetical protein | - |
| ACB343_RS06330 (ACB343_06330) | - | 1253095..1253472 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| ACB343_RS06335 (ACB343_06335) | - | 1253533..1254009 (-) | 477 | WP_174132581.1 | GNAT family N-acetyltransferase | - |
| ACB343_RS06340 (ACB343_06340) | - | 1253925..1254602 (-) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| ACB343_RS06345 (ACB343_06345) | - | 1254581..1255099 (-) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| ACB343_RS06350 (ACB343_06350) | - | 1255180..1255437 (+) | 258 | WP_011054748.1 | hypothetical protein | - |
| ACB343_RS06355 (ACB343_06355) | - | 1256076..1256516 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB343_RS06360 (ACB343_06360) | - | 1256790..1256960 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| ACB343_RS06365 (ACB343_06365) | - | 1256957..1257463 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| ACB343_RS06370 (ACB343_06370) | - | 1257460..1257630 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| ACB343_RS06375 (ACB343_06375) | - | 1257627..1258031 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| ACB343_RS06380 (ACB343_06380) | - | 1258041..1258310 (-) | 270 | WP_011054754.1 | hypothetical protein | - |
| ACB343_RS06385 (ACB343_06385) | - | 1258307..1258591 (-) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| ACB343_RS06390 (ACB343_06390) | - | 1258585..1258836 (-) | 252 | WP_011054756.1 | hypothetical protein | - |
| ACB343_RS06395 (ACB343_06395) | - | 1258833..1259189 (-) | 357 | WP_011054757.1 | hypothetical protein | - |
| ACB343_RS06400 (ACB343_06400) | - | 1259186..1259626 (-) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACB343_RS06405 (ACB343_06405) | - | 1259626..1259829 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| ACB343_RS06410 (ACB343_06410) | ssbA | 1259835..1260254 (-) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| ACB343_RS06415 (ACB343_06415) | - | 1260247..1260921 (-) | 675 | WP_011054760.1 | ERF family protein | - |
| ACB343_RS06420 (ACB343_06420) | - | 1260922..1261404 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| ACB343_RS06425 (ACB343_06425) | - | 1261426..1261680 (-) | 255 | WP_011054761.1 | hypothetical protein | - |
| ACB343_RS06430 (ACB343_06430) | - | 1261691..1261831 (-) | 141 | WP_011284979.1 | hypothetical protein | - |
| ACB343_RS06435 (ACB343_06435) | - | 1261828..1262061 (-) | 234 | WP_011054762.1 | hypothetical protein | - |
| ACB343_RS06440 (ACB343_06440) | - | 1262042..1262455 (-) | 414 | WP_011054763.1 | DnaD domain protein | - |
| ACB343_RS06445 (ACB343_06445) | - | 1262577..1262834 (-) | 258 | WP_011106684.1 | hypothetical protein | - |
| ACB343_RS06450 (ACB343_06450) | - | 1262928..1263113 (-) | 186 | WP_011054765.1 | hypothetical protein | - |
| ACB343_RS06455 (ACB343_06455) | - | 1263142..1263399 (-) | 258 | WP_002988339.1 | hypothetical protein | - |
| ACB343_RS06460 (ACB343_06460) | - | 1263645..1263812 (-) | 168 | WP_002986885.1 | hypothetical protein | - |
| ACB343_RS06465 (ACB343_06465) | - | 1263888..1264088 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| ACB343_RS06470 (ACB343_06470) | - | 1264085..1264234 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| ACB343_RS06475 (ACB343_06475) | - | 1264267..1264995 (-) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| ACB343_RS06480 (ACB343_06480) | - | 1265006..1265197 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| ACB343_RS06485 (ACB343_06485) | - | 1265993..1266352 (+) | 360 | WP_011054768.1 | helix-turn-helix domain-containing protein | - |
| ACB343_RS06490 (ACB343_06490) | - | 1266366..1266746 (+) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB343_RS06495 (ACB343_06495) | - | 1266757..1267278 (+) | 522 | WP_002986895.1 | hypothetical protein | - |
| ACB343_RS06500 (ACB343_06500) | - | 1267454..1268551 (+) | 1098 | WP_015967409.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6771.70 Da Isoelectric Point: 3.9944
>NTDB_id=1037486 ACB343_RS06175 WP_011054726.1 1226522..1226704(-) (prx) [Streptococcus pyogenes strain Isolate 17]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1037486 ACB343_RS06175 WP_011054726.1 1226522..1226704(-) (prx) [Streptococcus pyogenes strain Isolate 17]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |