Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB343_RS04920 | Genome accession | NZ_CP167012 |
| Coordinates | 985831..986019 (-) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 17 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 978247..1032773 | 985831..986019 | within | 0 |
Gene organization within MGE regions
Location: 978247..1032773
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB343_RS04885 (ACB343_04885) | pfkA | 978247..979260 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| ACB343_RS04890 (ACB343_04890) | - | 979340..982450 (-) | 3111 | WP_011284836.1 | DNA polymerase III subunit alpha | - |
| ACB343_RS04895 (ACB343_04895) | - | 982635..983006 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| ACB343_RS04900 (ACB343_04900) | - | 983006..983704 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ACB343_RS04905 (ACB343_04905) | - | 983714..984499 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| ACB343_RS04910 (ACB343_04910) | - | 984626..985240 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| ACB343_RS04920 (ACB343_04920) | prx | 985831..986019 (-) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| ACB343_RS04925 (ACB343_04925) | mf2 | 986259..987017 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| ACB343_RS04930 (ACB343_04930) | speC | 987128..987835 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| ACB343_RS04935 (ACB343_04935) | - | 987911..989245 (-) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| ACB343_RS04940 (ACB343_04940) | - | 989357..989542 (-) | 186 | WP_011284839.1 | holin | - |
| ACB343_RS04945 (ACB343_04945) | - | 989539..989835 (-) | 297 | WP_002990012.1 | hypothetical protein | - |
| ACB343_RS04950 (ACB343_04950) | - | 989846..990463 (-) | 618 | WP_011284840.1 | hypothetical protein | - |
| ACB343_RS04955 (ACB343_04955) | - | 990466..990627 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ACB343_RS04960 (ACB343_04960) | - | 990641..992536 (-) | 1896 | WP_371399926.1 | gp58-like family protein | - |
| ACB343_RS04965 (ACB343_04965) | - | 992547..992861 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| ACB343_RS04970 (ACB343_04970) | - | 992863..994077 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| ACB343_RS04975 (ACB343_04975) | - | 994074..996128 (-) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| ACB343_RS04980 (ACB343_04980) | - | 996125..996904 (-) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| ACB343_RS04985 (ACB343_04985) | - | 996936..1000571 (-) | 3636 | WP_011284846.1 | tape measure protein | - |
| ACB343_RS04990 (ACB343_04990) | - | 1000586..1000882 (-) | 297 | WP_021340179.1 | hypothetical protein | - |
| ACB343_RS04995 (ACB343_04995) | - | 1000957..1001310 (-) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| ACB343_RS05000 (ACB343_05000) | - | 1001364..1001987 (-) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| ACB343_RS05005 (ACB343_05005) | - | 1002042..1002431 (-) | 390 | WP_011284850.1 | hypothetical protein | - |
| ACB343_RS05010 (ACB343_05010) | - | 1002428..1002793 (-) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACB343_RS05015 (ACB343_05015) | - | 1002774..1003082 (-) | 309 | WP_011284852.1 | hypothetical protein | - |
| ACB343_RS05020 (ACB343_05020) | - | 1003079..1003432 (-) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| ACB343_RS05025 (ACB343_05025) | - | 1003446..1003688 (-) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| ACB343_RS05030 (ACB343_05030) | - | 1003698..1004780 (-) | 1083 | WP_011284855.1 | major capsid protein | - |
| ACB343_RS05035 (ACB343_05035) | - | 1004783..1005163 (-) | 381 | WP_011284856.1 | head decoration protein | - |
| ACB343_RS05040 (ACB343_05040) | - | 1005173..1005706 (-) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| ACB343_RS05045 (ACB343_05045) | - | 1005850..1006116 (-) | 267 | WP_011284858.1 | hypothetical protein | - |
| ACB343_RS05050 (ACB343_05050) | - | 1006119..1006433 (-) | 315 | WP_011284859.1 | hypothetical protein | - |
| ACB343_RS05055 (ACB343_05055) | - | 1006503..1006688 (-) | 186 | WP_002988389.1 | hypothetical protein | - |
| ACB343_RS05060 (ACB343_05060) | - | 1006692..1008254 (-) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| ACB343_RS05065 (ACB343_05065) | - | 1008235..1009737 (-) | 1503 | WP_002984369.1 | phage portal protein | - |
| ACB343_RS05070 (ACB343_05070) | - | 1009749..1011056 (-) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| ACB343_RS05075 (ACB343_05075) | - | 1011034..1011465 (-) | 432 | WP_023079766.1 | terminase small subunit | - |
| ACB343_RS05080 (ACB343_05080) | - | 1011564..1011749 (+) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| ACB343_RS05085 (ACB343_05085) | - | 1011801..1012178 (+) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| ACB343_RS05090 (ACB343_05090) | - | 1012473..1012706 (+) | 234 | WP_002995461.1 | hypothetical protein | - |
| ACB343_RS05095 (ACB343_05095) | - | 1012796..1013710 (-) | 915 | WP_011284864.1 | hypothetical protein | - |
| ACB343_RS05100 (ACB343_05100) | - | 1014288..1014722 (-) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB343_RS05105 (ACB343_05105) | - | 1015004..1015174 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| ACB343_RS05110 (ACB343_05110) | - | 1015171..1015650 (-) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| ACB343_RS05115 (ACB343_05115) | - | 1015655..1016287 (-) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| ACB343_RS05120 (ACB343_05120) | - | 1016289..1016573 (-) | 285 | WP_011284869.1 | hypothetical protein | - |
| ACB343_RS05125 (ACB343_05125) | - | 1016570..1016740 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| ACB343_RS05130 (ACB343_05130) | - | 1016737..1016973 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| ACB343_RS05135 (ACB343_05135) | - | 1016973..1017218 (-) | 246 | WP_011284872.1 | hypothetical protein | - |
| ACB343_RS05140 (ACB343_05140) | - | 1017215..1017571 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| ACB343_RS05145 (ACB343_05145) | - | 1017555..1017839 (-) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| ACB343_RS05150 (ACB343_05150) | - | 1017859..1018728 (-) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| ACB343_RS05155 (ACB343_05155) | - | 1018997..1020550 (-) | 1554 | WP_011284875.1 | hypothetical protein | - |
| ACB343_RS05160 (ACB343_05160) | - | 1020568..1021050 (-) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| ACB343_RS05165 (ACB343_05165) | - | 1021055..1022479 (-) | 1425 | Protein_970 | DEAD/DEAH box helicase | - |
| ACB343_RS05170 (ACB343_05170) | - | 1022494..1023177 (-) | 684 | WP_002984321.1 | AAA family ATPase | - |
| ACB343_RS05175 (ACB343_05175) | - | 1023174..1023458 (-) | 285 | WP_011284877.1 | hypothetical protein | - |
| ACB343_RS05180 (ACB343_05180) | - | 1023455..1023649 (-) | 195 | WP_002984315.1 | hypothetical protein | - |
| ACB343_RS05185 (ACB343_05185) | - | 1023649..1023978 (-) | 330 | WP_011284878.1 | hypothetical protein | - |
| ACB343_RS05190 (ACB343_05190) | - | 1024059..1024196 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| ACB343_RS05195 (ACB343_05195) | - | 1024193..1024489 (-) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| ACB343_RS05200 (ACB343_05200) | - | 1024568..1024753 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| ACB343_RS05205 (ACB343_05205) | - | 1024920..1025159 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| ACB343_RS05210 (ACB343_05210) | - | 1025309..1025518 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| ACB343_RS05215 (ACB343_05215) | - | 1025777..1026286 (+) | 510 | WP_047298031.1 | hypothetical protein | - |
| ACB343_RS05220 (ACB343_05220) | - | 1026394..1026621 (-) | 228 | WP_002984281.1 | hypothetical protein | - |
| ACB343_RS05225 (ACB343_05225) | - | 1026695..1027081 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| ACB343_RS05230 (ACB343_05230) | - | 1027070..1027279 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| ACB343_RS05235 (ACB343_05235) | - | 1027333..1027932 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| ACB343_RS05240 (ACB343_05240) | - | 1027962..1028120 (-) | 159 | WP_011284883.1 | hypothetical protein | - |
| ACB343_RS05245 (ACB343_05245) | - | 1028179..1028394 (+) | 216 | WP_021341080.1 | hypothetical protein | - |
| ACB343_RS05250 (ACB343_05250) | - | 1028380..1028529 (-) | 150 | WP_021340643.1 | hypothetical protein | - |
| ACB343_RS05255 (ACB343_05255) | - | 1028887..1029630 (+) | 744 | WP_011284884.1 | XRE family transcriptional regulator | - |
| ACB343_RS05260 (ACB343_05260) | - | 1029643..1030452 (+) | 810 | WP_023079768.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| ACB343_RS05265 (ACB343_05265) | - | 1030702..1031790 (+) | 1089 | WP_023079773.1 | site-specific integrase | - |
| ACB343_RS05270 (ACB343_05270) | - | 1032153..1032773 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=1037481 ACB343_RS04920 WP_002993136.1 985831..986019(-) (prx) [Streptococcus pyogenes strain Isolate 17]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1037481 ACB343_RS04920 WP_002993136.1 985831..986019(-) (prx) [Streptococcus pyogenes strain Isolate 17]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |