Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB355_RS06730 | Genome accession | NZ_CP167011 |
| Coordinates | 1336096..1336278 (-) | Length | 60 a.a. |
| NCBI ID | WP_011018104.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 18 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1336096..1376360 | 1336096..1336278 | within | 0 |
Gene organization within MGE regions
Location: 1336096..1376360
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB355_RS06730 (ACB355_06730) | prx | 1336096..1336278 (-) | 183 | WP_011018104.1 | hypothetical protein | Regulator |
| ACB355_RS06735 (ACB355_06735) | mf2 | 1336551..1337309 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| ACB355_RS06740 (ACB355_06740) | speC | 1337420..1338127 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| ACB355_RS06745 (ACB355_06745) | - | 1338739..1339948 (-) | 1210 | Protein_1285 | glucosaminidase domain-containing protein | - |
| ACB355_RS06750 (ACB355_06750) | - | 1340060..1340515 (-) | 456 | WP_002988455.1 | phage holin family protein | - |
| ACB355_RS06755 (ACB355_06755) | - | 1340531..1341157 (-) | 627 | WP_115224617.1 | hypothetical protein | - |
| ACB355_RS06760 (ACB355_06760) | - | 1341160..1341588 (-) | 429 | WP_115224618.1 | DUF1617 family protein | - |
| ACB355_RS06765 (ACB355_06765) | - | 1341600..1343486 (-) | 1887 | WP_115224619.1 | gp58-like family protein | - |
| ACB355_RS06770 (ACB355_06770) | hylP | 1343499..1344521 (-) | 1023 | WP_020837648.1 | hyaluronidase HylP | - |
| ACB355_RS06775 (ACB355_06775) | - | 1344518..1346662 (-) | 2145 | WP_115224620.1 | phage tail spike protein | - |
| ACB355_RS06780 (ACB355_06780) | - | 1346659..1347375 (-) | 717 | WP_115224621.1 | distal tail protein Dit | - |
| ACB355_RS06785 (ACB355_06785) | - | 1347372..1350632 (-) | 3261 | WP_371394834.1 | tape measure protein | - |
| ACB355_RS06790 (ACB355_06790) | - | 1350622..1351203 (-) | 582 | WP_010922087.1 | bacteriophage Gp15 family protein | - |
| ACB355_RS06795 (ACB355_06795) | - | 1351207..1351641 (-) | 435 | WP_010922086.1 | hypothetical protein | - |
| ACB355_RS06800 (ACB355_06800) | - | 1351680..1352165 (-) | 486 | WP_011054741.1 | phage tail tube protein | - |
| ACB355_RS06805 (ACB355_06805) | - | 1352165..1352563 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| ACB355_RS06810 (ACB355_06810) | - | 1352560..1352916 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| ACB355_RS06815 (ACB355_06815) | - | 1352916..1353248 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| ACB355_RS06820 (ACB355_06820) | - | 1353238..1353654 (-) | 417 | WP_010922081.1 | hypothetical protein | - |
| ACB355_RS06825 (ACB355_06825) | - | 1353708..1354526 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| ACB355_RS06830 (ACB355_06830) | - | 1354530..1355144 (-) | 615 | WP_115224623.1 | hypothetical protein | - |
| ACB355_RS06835 (ACB355_06835) | - | 1355270..1355536 (-) | 267 | WP_010922078.1 | hypothetical protein | - |
| ACB355_RS06840 (ACB355_06840) | - | 1355623..1355850 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| ACB355_RS06845 (ACB355_06845) | - | 1355850..1357343 (-) | 1494 | WP_010922076.1 | phage minor capsid protein | - |
| ACB355_RS06850 (ACB355_06850) | - | 1357348..1358850 (-) | 1503 | WP_010922075.1 | phage portal protein | - |
| ACB355_RS06855 (ACB355_06855) | - | 1358864..1360155 (-) | 1292 | Protein_1307 | PBSX family phage terminase large subunit | - |
| ACB355_RS06860 (ACB355_06860) | - | 1360158..1360634 (-) | 477 | WP_010922073.1 | hypothetical protein | - |
| ACB355_RS06865 (ACB355_06865) | - | 1360977..1362143 (-) | 1167 | WP_115224624.1 | DNA modification methylase | - |
| ACB355_RS06870 (ACB355_06870) | - | 1362477..1362914 (-) | 438 | WP_003052405.1 | DUF1492 domain-containing protein | - |
| ACB355_RS06875 (ACB355_06875) | - | 1363116..1363337 (+) | 222 | WP_032467171.1 | hypothetical protein | - |
| ACB355_RS06880 (ACB355_06880) | - | 1363370..1363663 (-) | 294 | WP_011888761.1 | hypothetical protein | - |
| ACB355_RS06885 (ACB355_06885) | - | 1363754..1364518 (-) | 765 | WP_021299463.1 | site-specific DNA-methyltransferase | - |
| ACB355_RS06890 (ACB355_06890) | - | 1364508..1364777 (-) | 270 | WP_115224625.1 | hypothetical protein | - |
| ACB355_RS06895 (ACB355_06895) | - | 1364782..1364967 (-) | 186 | WP_011017985.1 | hypothetical protein | - |
| ACB355_RS06900 (ACB355_06900) | - | 1364954..1365466 (-) | 513 | WP_115224626.1 | hypothetical protein | - |
| ACB355_RS06905 (ACB355_06905) | - | 1365463..1365804 (-) | 342 | WP_161737273.1 | hypothetical protein | - |
| ACB355_RS06910 (ACB355_06910) | - | 1365885..1366052 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| ACB355_RS06915 (ACB355_06915) | - | 1366062..1366859 (-) | 798 | WP_115224628.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACB355_RS06920 (ACB355_06920) | - | 1366856..1367821 (-) | 966 | WP_115224629.1 | recombinase RecT | - |
| ACB355_RS06925 (ACB355_06925) | - | 1367824..1368153 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| ACB355_RS06930 (ACB355_06930) | - | 1368175..1368429 (-) | 255 | WP_063629029.1 | hypothetical protein | - |
| ACB355_RS06935 (ACB355_06935) | - | 1368416..1368763 (-) | 348 | WP_012560971.1 | hypothetical protein | - |
| ACB355_RS06940 (ACB355_06940) | - | 1368904..1369686 (-) | 783 | WP_111705650.1 | ATP-binding protein | - |
| ACB355_RS06945 (ACB355_06945) | - | 1369673..1370434 (-) | 762 | WP_014635613.1 | DnaD domain protein | - |
| ACB355_RS06950 (ACB355_06950) | - | 1370528..1370665 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| ACB355_RS06955 (ACB355_06955) | - | 1370696..1370947 (-) | 252 | WP_011888682.1 | AlpA family transcriptional regulator | - |
| ACB355_RS06960 (ACB355_06960) | - | 1371018..1371203 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| ACB355_RS06965 (ACB355_06965) | - | 1371370..1371609 (+) | 240 | WP_115224630.1 | hypothetical protein | - |
| ACB355_RS06970 (ACB355_06970) | - | 1371707..1372426 (-) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| ACB355_RS06975 (ACB355_06975) | - | 1372454..1372666 (-) | 213 | WP_014635614.1 | DNA-binding protein | - |
| ACB355_RS06980 (ACB355_06980) | - | 1372864..1373205 (+) | 342 | WP_011888679.1 | helix-turn-helix transcriptional regulator | - |
| ACB355_RS06985 (ACB355_06985) | - | 1373189..1373575 (+) | 387 | WP_023605207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB355_RS06990 (ACB355_06990) | - | 1373590..1375011 (+) | 1422 | WP_014635616.1 | DUF4041 domain-containing protein | - |
| ACB355_RS06995 (ACB355_06995) | - | 1375194..1376360 (+) | 1167 | WP_011018152.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6935.81 Da Isoelectric Point: 3.9417
>NTDB_id=1037433 ACB355_RS06730 WP_011018104.1 1336096..1336278(-) (prx) [Streptococcus pyogenes strain Isolate 18]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1037433 ACB355_RS06730 WP_011018104.1 1336096..1336278(-) (prx) [Streptococcus pyogenes strain Isolate 18]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
93.023 |
71.667 |
0.667 |