Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB333_RS05850 | Genome accession | NZ_CP167010 |
| Coordinates | 1164190..1164372 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054671.1 | Uniprot ID | Q4VUT1 |
| Organism | Streptococcus pyogenes strain Isolate 20 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1164190..1198678 | 1164190..1164372 | within | 0 |
Gene organization within MGE regions
Location: 1164190..1198678
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB333_RS05850 (ACB333_05855) | prx | 1164190..1164372 (-) | 183 | WP_011054671.1 | hypothetical protein | Regulator |
| ACB333_RS05855 (ACB333_05860) | - | 1164439..1165233 (-) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| ACB333_RS05860 (ACB333_05865) | - | 1165478..1166692 (-) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| ACB333_RS05865 (ACB333_05870) | - | 1166804..1167259 (-) | 456 | WP_002983475.1 | phage holin family protein | - |
| ACB333_RS05870 (ACB333_05875) | - | 1167270..1167884 (-) | 615 | WP_011054672.1 | DUF1366 domain-containing protein | - |
| ACB333_RS05875 (ACB333_05880) | - | 1167887..1168318 (-) | 432 | WP_011054673.1 | DUF1617 family protein | - |
| ACB333_RS05880 (ACB333_05885) | - | 1168327..1170108 (-) | 1782 | WP_011054674.1 | gp58-like family protein | - |
| ACB333_RS05885 (ACB333_05890) | - | 1170123..1171232 (-) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| ACB333_RS05890 (ACB333_05895) | - | 1171232..1173205 (-) | 1974 | WP_032461270.1 | phage tail spike protein | - |
| ACB333_RS05895 (ACB333_05900) | - | 1173187..1173882 (-) | 696 | WP_371392479.1 | hypothetical protein | - |
| ACB333_RS05900 (ACB333_05905) | - | 1173879..1176242 (-) | 2364 | WP_371392481.1 | hypothetical protein | - |
| ACB333_RS05905 (ACB333_05910) | - | 1176242..1176613 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| ACB333_RS05910 (ACB333_05915) | - | 1176628..1176891 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| ACB333_RS05915 (ACB333_05920) | - | 1176902..1177492 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| ACB333_RS05920 (ACB333_05925) | - | 1177508..1177843 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| ACB333_RS05925 (ACB333_05930) | - | 1177844..1178080 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| ACB333_RS05930 (ACB333_05935) | - | 1178073..1178411 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| ACB333_RS05935 (ACB333_05940) | - | 1178371..1178793 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ACB333_RS05940 (ACB333_05945) | - | 1178803..1179003 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| ACB333_RS05945 (ACB333_05950) | - | 1179003..1179914 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| ACB333_RS05950 (ACB333_05955) | - | 1179939..1180400 (-) | 462 | WP_011054684.1 | DUF4355 domain-containing protein | - |
| ACB333_RS05955 (ACB333_05960) | - | 1180481..1181896 (-) | 1416 | WP_011054685.1 | terminase | - |
| ACB333_RS05960 (ACB333_05965) | - | 1181978..1182193 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| ACB333_RS05965 (ACB333_05970) | - | 1182195..1182461 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| ACB333_RS05970 (ACB333_05975) | - | 1182454..1182606 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| ACB333_RS05975 (ACB333_05980) | - | 1182683..1182907 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| ACB333_RS05980 (ACB333_05985) | - | 1182913..1184406 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| ACB333_RS05985 (ACB333_05990) | - | 1184399..1185667 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| ACB333_RS05990 (ACB333_05995) | - | 1185664..1186020 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| ACB333_RS05995 (ACB333_06000) | - | 1186168..1186512 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| ACB333_RS06000 (ACB333_06005) | - | 1186620..1187039 (-) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| ACB333_RS06005 (ACB333_06010) | - | 1187115..1187366 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| ACB333_RS06010 (ACB333_06015) | - | 1187363..1187518 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| ACB333_RS06015 (ACB333_06020) | - | 1187515..1187832 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| ACB333_RS06020 (ACB333_06025) | - | 1187868..1188380 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| ACB333_RS06025 (ACB333_06030) | - | 1188377..1188709 (-) | 333 | WP_011054696.1 | hypothetical protein | - |
| ACB333_RS06030 (ACB333_06035) | - | 1188720..1190066 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| ACB333_RS06035 (ACB333_06040) | - | 1190063..1190458 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| ACB333_RS06040 (ACB333_06045) | - | 1190823..1191620 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACB333_RS06045 (ACB333_06050) | - | 1191613..1191813 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| ACB333_RS06050 (ACB333_06055) | - | 1191810..1192736 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| ACB333_RS06055 (ACB333_06060) | - | 1192739..1193069 (-) | 331 | Protein_1159 | hypothetical protein | - |
| ACB333_RS06060 (ACB333_06065) | - | 1193125..1193331 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| ACB333_RS06065 (ACB333_06070) | - | 1193340..1193480 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| ACB333_RS06070 (ACB333_06075) | - | 1193477..1193710 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| ACB333_RS06075 (ACB333_06080) | - | 1193691..1194077 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| ACB333_RS06080 (ACB333_06085) | - | 1194218..1194487 (-) | 270 | WP_011106700.1 | replication protein | - |
| ACB333_RS06085 (ACB333_06090) | - | 1194581..1194766 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| ACB333_RS06090 (ACB333_06095) | - | 1194768..1195079 (-) | 312 | WP_010922478.1 | excisionase | - |
| ACB333_RS06095 (ACB333_06100) | - | 1195349..1195561 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| ACB333_RS06100 (ACB333_06105) | - | 1195763..1196518 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| ACB333_RS06105 (ACB333_06110) | - | 1196530..1197048 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| ACB333_RS06110 (ACB333_06115) | - | 1197172..1198314 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ACB333_RS06115 (ACB333_06120) | - | 1198403..1198678 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6978.99 Da Isoelectric Point: 4.3466
>NTDB_id=1037370 ACB333_RS05850 WP_011054671.1 1164190..1164372(-) (prx) [Streptococcus pyogenes strain Isolate 20]
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1037370 ACB333_RS05850 WP_011054671.1 1164190..1164372(-) (prx) [Streptococcus pyogenes strain Isolate 20]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |