Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB333_RS05005 | Genome accession | NZ_CP167010 |
| Coordinates | 1002450..1002638 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 20 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 994866..1041175 | 1002450..1002638 | within | 0 |
Gene organization within MGE regions
Location: 994866..1041175
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB333_RS04970 (ACB333_04975) | pfkA | 994866..995879 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| ACB333_RS04975 (ACB333_04980) | - | 995959..999069 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| ACB333_RS04980 (ACB333_04985) | - | 999254..999625 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| ACB333_RS04985 (ACB333_04990) | - | 999625..1000323 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ACB333_RS04990 (ACB333_04995) | - | 1000333..1001118 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| ACB333_RS04995 (ACB333_05000) | - | 1001245..1001859 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| ACB333_RS05005 (ACB333_05010) | prx | 1002450..1002638 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| ACB333_RS05010 (ACB333_05015) | speA | 1002858..1003613 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| ACB333_RS05015 (ACB333_05020) | - | 1003735..1004394 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| ACB333_RS05020 (ACB333_05025) | - | 1004394..1004615 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| ACB333_RS05025 (ACB333_05030) | - | 1004625..1005398 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| ACB333_RS05030 (ACB333_05035) | - | 1005409..1006011 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| ACB333_RS05035 (ACB333_05040) | - | 1006023..1006787 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| ACB333_RS05040 (ACB333_05045) | - | 1006789..1007121 (-) | 333 | WP_011285562.1 | phage holin | - |
| ACB333_RS05045 (ACB333_05050) | - | 1007121..1007444 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| ACB333_RS05050 (ACB333_05055) | - | 1007458..1007580 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| ACB333_RS05055 (ACB333_05060) | - | 1007594..1007941 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| ACB333_RS05060 (ACB333_05065) | - | 1007952..1009814 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| ACB333_RS05065 (ACB333_05070) | - | 1009819..1013259 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| ACB333_RS05070 (ACB333_05075) | - | 1013260..1014744 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| ACB333_RS05075 (ACB333_05080) | - | 1014745..1016550 (-) | 1806 | WP_011054802.1 | tail protein | - |
| ACB333_RS05080 (ACB333_05085) | - | 1016543..1017001 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| ACB333_RS05085 (ACB333_05090) | - | 1016974..1017291 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| ACB333_RS05090 (ACB333_05095) | - | 1017304..1017810 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| ACB333_RS05095 (ACB333_05100) | - | 1017822..1018232 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| ACB333_RS05100 (ACB333_05105) | - | 1018234..1018629 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| ACB333_RS05105 (ACB333_05110) | - | 1018626..1018937 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| ACB333_RS05110 (ACB333_05115) | - | 1018934..1019278 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| ACB333_RS05115 (ACB333_05120) | - | 1019292..1019585 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| ACB333_RS05120 (ACB333_05125) | - | 1019598..1020488 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| ACB333_RS05125 (ACB333_05130) | - | 1020507..1021076 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| ACB333_RS05130 (ACB333_05135) | - | 1021185..1021319 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| ACB333_RS05135 (ACB333_05140) | - | 1021321..1021590 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| ACB333_RS05140 (ACB333_05145) | - | 1021597..1022505 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| ACB333_RS05145 (ACB333_05150) | - | 1022474..1023799 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| ACB333_RS05150 (ACB333_05155) | - | 1023799..1025073 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| ACB333_RS05155 (ACB333_05160) | - | 1025063..1025443 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| ACB333_RS05160 (ACB333_05165) | - | 1026053..1026487 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB333_RS05165 (ACB333_05170) | - | 1026772..1027038 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| ACB333_RS05170 (ACB333_05175) | - | 1027035..1027559 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| ACB333_RS05175 (ACB333_05180) | - | 1027562..1028194 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ACB333_RS05180 (ACB333_05185) | - | 1028196..1028480 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| ACB333_RS05185 (ACB333_05190) | - | 1028477..1028647 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| ACB333_RS05190 (ACB333_05195) | - | 1028644..1028880 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| ACB333_RS05195 (ACB333_05200) | - | 1028880..1029125 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| ACB333_RS05200 (ACB333_05205) | - | 1029122..1029478 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| ACB333_RS05205 (ACB333_05210) | - | 1029475..1029915 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACB333_RS05210 (ACB333_05215) | - | 1029915..1030118 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| ACB333_RS05215 (ACB333_05220) | ssb | 1030124..1030549 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| ACB333_RS05220 (ACB333_05225) | - | 1030542..1031216 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| ACB333_RS05225 (ACB333_05230) | - | 1031217..1031699 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| ACB333_RS05230 (ACB333_05235) | - | 1031721..1031975 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| ACB333_RS05235 (ACB333_05240) | - | 1031956..1032309 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| ACB333_RS05240 (ACB333_05245) | - | 1032450..1033232 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| ACB333_RS05245 (ACB333_05250) | - | 1033219..1034049 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACB333_RS05250 (ACB333_05255) | - | 1034063..1034251 (-) | 189 | Protein_998 | XRE family transcriptional regulator | - |
| ACB333_RS05255 (ACB333_05260) | - | 1034485..1034724 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| ACB333_RS05260 (ACB333_05265) | - | 1034855..1035064 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| ACB333_RS05265 (ACB333_05270) | - | 1035174..1035374 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| ACB333_RS05270 (ACB333_05275) | - | 1035448..1035834 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| ACB333_RS05275 (ACB333_05280) | - | 1035823..1036032 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| ACB333_RS05280 (ACB333_05285) | - | 1036086..1036685 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| ACB333_RS05285 (ACB333_05290) | - | 1036715..1036873 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| ACB333_RS05290 (ACB333_05295) | - | 1037230..1038054 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| ACB333_RS05295 (ACB333_05300) | - | 1038090..1038983 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| ACB333_RS05300 (ACB333_05305) | - | 1039104..1040192 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| ACB333_RS05305 (ACB333_05310) | - | 1040555..1041175 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=1037366 ACB333_RS05005 WP_011285559.1 1002450..1002638(-) (prx) [Streptococcus pyogenes strain Isolate 20]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1037366 ACB333_RS05005 WP_011285559.1 1002450..1002638(-) (prx) [Streptococcus pyogenes strain Isolate 20]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |