Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB342_RS05910 | Genome accession | NZ_CP167007 |
| Coordinates | 1170191..1170373 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054671.1 | Uniprot ID | Q4VUT1 |
| Organism | Streptococcus pyogenes strain Isolate 24 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1170191..1206203 | 1170191..1170373 | within | 0 |
Gene organization within MGE regions
Location: 1170191..1206203
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB342_RS05910 (ACB342_05915) | prx | 1170191..1170373 (-) | 183 | WP_011054671.1 | hypothetical protein | Regulator |
| ACB342_RS05915 (ACB342_05920) | - | 1170440..1171234 (-) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| ACB342_RS05920 (ACB342_05925) | - | 1171479..1172693 (-) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| ACB342_RS05925 (ACB342_05930) | - | 1172805..1173260 (-) | 456 | WP_002983475.1 | phage holin family protein | - |
| ACB342_RS05930 (ACB342_05935) | - | 1173271..1173885 (-) | 615 | WP_011054672.1 | DUF1366 domain-containing protein | - |
| ACB342_RS05935 (ACB342_05940) | - | 1173888..1174319 (-) | 432 | WP_011054673.1 | DUF1617 family protein | - |
| ACB342_RS05940 (ACB342_05945) | - | 1174328..1176109 (-) | 1782 | WP_011054674.1 | gp58-like family protein | - |
| ACB342_RS05945 (ACB342_05950) | - | 1176124..1177233 (-) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| ACB342_RS05950 (ACB342_05955) | - | 1177233..1179206 (-) | 1974 | WP_032461270.1 | phage tail spike protein | - |
| ACB342_RS05955 (ACB342_05960) | - | 1179188..1179883 (-) | 696 | WP_371392479.1 | hypothetical protein | - |
| ACB342_RS05960 (ACB342_05965) | - | 1179880..1182243 (-) | 2364 | WP_371392481.1 | hypothetical protein | - |
| ACB342_RS05965 (ACB342_05970) | - | 1182243..1182614 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| ACB342_RS05970 (ACB342_05975) | - | 1182629..1182892 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| ACB342_RS05975 (ACB342_05980) | - | 1182903..1183493 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| ACB342_RS05980 (ACB342_05985) | - | 1183509..1183844 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| ACB342_RS05985 (ACB342_05990) | - | 1183845..1184081 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| ACB342_RS05990 (ACB342_05995) | - | 1184074..1184412 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| ACB342_RS05995 (ACB342_06000) | - | 1184372..1184794 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ACB342_RS06000 (ACB342_06005) | - | 1184804..1185004 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| ACB342_RS06005 (ACB342_06010) | - | 1185004..1185915 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| ACB342_RS06010 (ACB342_06015) | - | 1185940..1186401 (-) | 462 | WP_011054684.1 | DUF4355 domain-containing protein | - |
| ACB342_RS06015 (ACB342_06020) | - | 1186482..1187897 (-) | 1416 | WP_011054685.1 | terminase | - |
| ACB342_RS06020 (ACB342_06025) | - | 1187979..1188194 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| ACB342_RS06025 (ACB342_06030) | - | 1188196..1188462 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| ACB342_RS06030 (ACB342_06035) | - | 1188455..1188607 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| ACB342_RS06035 (ACB342_06040) | - | 1188684..1188908 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| ACB342_RS06040 (ACB342_06045) | - | 1188914..1190407 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| ACB342_RS06045 (ACB342_06050) | - | 1190400..1191668 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| ACB342_RS06050 (ACB342_06055) | - | 1191665..1192021 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| ACB342_RS06055 (ACB342_06060) | - | 1192169..1192513 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| ACB342_RS06060 (ACB342_06065) | - | 1192621..1193040 (-) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| ACB342_RS06065 (ACB342_06070) | - | 1193116..1193367 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| ACB342_RS06070 (ACB342_06075) | - | 1193364..1193519 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| ACB342_RS06075 (ACB342_06080) | - | 1193516..1193833 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| ACB342_RS06080 (ACB342_06085) | - | 1193869..1194381 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| ACB342_RS06085 (ACB342_06090) | - | 1194378..1194710 (-) | 333 | WP_011054696.1 | hypothetical protein | - |
| ACB342_RS06090 (ACB342_06095) | - | 1194721..1196067 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| ACB342_RS06095 (ACB342_06100) | - | 1196064..1196459 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| ACB342_RS06100 (ACB342_06105) | - | 1196824..1197621 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACB342_RS06105 (ACB342_06110) | - | 1197614..1197814 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| ACB342_RS06110 (ACB342_06115) | - | 1197811..1198737 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| ACB342_RS06115 (ACB342_06120) | - | 1198740..1199070 (-) | 331 | Protein_1158 | hypothetical protein | - |
| ACB342_RS06120 (ACB342_06125) | - | 1199126..1199332 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| ACB342_RS06125 (ACB342_06130) | - | 1199341..1199481 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| ACB342_RS06130 (ACB342_06135) | - | 1199478..1199711 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| ACB342_RS06135 (ACB342_06140) | - | 1199692..1200078 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| ACB342_RS06140 (ACB342_06145) | - | 1200219..1200488 (-) | 270 | WP_011106700.1 | replication protein | - |
| ACB342_RS06145 (ACB342_06150) | - | 1200582..1200767 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| ACB342_RS06150 (ACB342_06155) | - | 1200769..1201080 (-) | 312 | WP_010922478.1 | excisionase | - |
| ACB342_RS06155 (ACB342_06160) | - | 1201350..1201562 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| ACB342_RS06160 (ACB342_06165) | - | 1201764..1202519 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| ACB342_RS06165 (ACB342_06170) | - | 1202531..1203049 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| ACB342_RS06170 (ACB342_06175) | - | 1203173..1204315 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ACB342_RS06175 (ACB342_06180) | - | 1204404..1204679 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ACB342_RS06180 (ACB342_06185) | - | 1204778..1205365 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| ACB342_RS06185 (ACB342_06190) | - | 1205343..1206185 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6978.99 Da Isoelectric Point: 4.3466
>NTDB_id=1037205 ACB342_RS05910 WP_011054671.1 1170191..1170373(-) (prx) [Streptococcus pyogenes strain Isolate 24]
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1037205 ACB342_RS05910 WP_011054671.1 1170191..1170373(-) (prx) [Streptococcus pyogenes strain Isolate 24]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |