Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB360_RS06335 | Genome accession | NZ_CP167006 |
| Coordinates | 1292447..1292626 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain Isolate 26 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1292447..1333064 | 1292447..1292626 | within | 0 |
Gene organization within MGE regions
Location: 1292447..1333064
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB360_RS06335 (ACB360_06335) | prx | 1292447..1292626 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ACB360_RS06340 (ACB360_06340) | sda1 | 1292865..1294037 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ACB360_RS06345 (ACB360_06345) | - | 1294153..1295349 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ACB360_RS06350 (ACB360_06350) | - | 1295460..1295645 (-) | 186 | WP_002988802.1 | holin | - |
| ACB360_RS06355 (ACB360_06355) | - | 1295642..1295941 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ACB360_RS06360 (ACB360_06360) | - | 1295952..1296572 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ACB360_RS06365 (ACB360_06365) | - | 1296575..1296736 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ACB360_RS06370 (ACB360_06370) | - | 1296745..1298652 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| ACB360_RS06375 (ACB360_06375) | - | 1298663..1299298 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| ACB360_RS06380 (ACB360_06380) | - | 1299298..1300353 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ACB360_RS06385 (ACB360_06385) | - | 1300350..1302332 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ACB360_RS06390 (ACB360_06390) | - | 1302342..1303184 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ACB360_RS06395 (ACB360_06395) | - | 1303196..1307578 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ACB360_RS06400 (ACB360_06400) | - | 1307593..1307826 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ACB360_RS06405 (ACB360_06405) | - | 1307901..1308356 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ACB360_RS06410 (ACB360_06410) | - | 1308410..1309009 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ACB360_RS06415 (ACB360_06415) | - | 1309021..1309380 (-) | 360 | WP_371395727.1 | hypothetical protein | - |
| ACB360_RS06420 (ACB360_06420) | - | 1309384..1309728 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACB360_RS06425 (ACB360_06425) | - | 1309725..1310003 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ACB360_RS06430 (ACB360_06430) | - | 1310014..1310370 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ACB360_RS06435 (ACB360_06435) | - | 1310382..1311269 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| ACB360_RS06440 (ACB360_06440) | - | 1311282..1311851 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ACB360_RS06445 (ACB360_06445) | - | 1312007..1312273 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ACB360_RS06450 (ACB360_06450) | - | 1312276..1312464 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ACB360_RS06455 (ACB360_06455) | - | 1312495..1313940 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ACB360_RS06460 (ACB360_06460) | - | 1313900..1315432 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| ACB360_RS06465 (ACB360_06465) | - | 1315448..1316725 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ACB360_RS06470 (ACB360_06470) | - | 1316715..1317167 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ACB360_RS06475 (ACB360_06475) | - | 1317257..1317673 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ACB360_RS06480 (ACB360_06480) | - | 1317670..1317861 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ACB360_RS06485 (ACB360_06485) | - | 1317851..1318702 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| ACB360_RS06490 (ACB360_06490) | - | 1318711..1318977 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ACB360_RS06495 (ACB360_06495) | - | 1318974..1319141 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ACB360_RS06500 (ACB360_06500) | - | 1319142..1320464 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ACB360_RS06505 (ACB360_06505) | - | 1320461..1320736 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ACB360_RS06510 (ACB360_06510) | - | 1321123..1323507 (-) | 2385 | WP_346393453.1 | phage/plasmid primase, P4 family | - |
| ACB360_RS06515 (ACB360_06515) | - | 1323512..1325434 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ACB360_RS06520 (ACB360_06520) | - | 1325477..1326034 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ACB360_RS06525 (ACB360_06525) | - | 1326045..1326443 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ACB360_RS06530 (ACB360_06530) | - | 1326447..1327601 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ACB360_RS06535 (ACB360_06535) | - | 1327601..1327900 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ACB360_RS06540 (ACB360_06540) | - | 1327988..1328191 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ACB360_RS06545 (ACB360_06545) | - | 1328338..1328724 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ACB360_RS06550 (ACB360_06550) | - | 1328721..1328924 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ACB360_RS06555 (ACB360_06555) | - | 1328917..1329087 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ACB360_RS06560 (ACB360_06560) | - | 1329084..1329359 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ACB360_RS06565 (ACB360_06565) | - | 1329421..1329636 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ACB360_RS06570 (ACB360_06570) | - | 1329684..1330097 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ACB360_RS06575 (ACB360_06575) | - | 1330078..1330233 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ACB360_RS06580 (ACB360_06580) | - | 1330559..1330909 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| ACB360_RS06585 (ACB360_06585) | - | 1330923..1331306 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB360_RS06590 (ACB360_06590) | - | 1331317..1331868 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ACB360_RS06595 (ACB360_06595) | - | 1331985..1333064 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=1037162 ACB360_RS06335 WP_002988813.1 1292447..1292626(-) (prx) [Streptococcus pyogenes strain Isolate 26]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1037162 ACB360_RS06335 WP_002988813.1 1292447..1292626(-) (prx) [Streptococcus pyogenes strain Isolate 26]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |