Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB354_RS04060 | Genome accession | NZ_CP167004 |
| Coordinates | 735299..735481 (+) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 28 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 697580..735481 | 735299..735481 | within | 0 |
Gene organization within MGE regions
Location: 697580..735481
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB354_RS03770 (ACB354_03770) | - | 697598..698440 (+) | 843 | WP_011888746.1 | SGNH/GDSL hydrolase family protein | - |
| ACB354_RS03775 (ACB354_03775) | - | 698418..699005 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| ACB354_RS03780 (ACB354_03780) | - | 699104..699379 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ACB354_RS03785 (ACB354_03785) | - | 699468..700610 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ACB354_RS03790 (ACB354_03790) | - | 700734..701252 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| ACB354_RS03795 (ACB354_03795) | - | 701264..702019 (-) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| ACB354_RS03800 (ACB354_03800) | - | 702220..702432 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| ACB354_RS03805 (ACB354_03805) | - | 702702..703013 (+) | 312 | WP_010922478.1 | excisionase | - |
| ACB354_RS03810 (ACB354_03810) | - | 703015..703200 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| ACB354_RS03815 (ACB354_03815) | - | 703294..703563 (+) | 270 | WP_011106700.1 | replication protein | - |
| ACB354_RS03820 (ACB354_03820) | - | 703704..704090 (+) | 387 | WP_002990076.1 | DnaD domain-containing protein | - |
| ACB354_RS03825 (ACB354_03825) | - | 704071..704304 (+) | 234 | WP_002988350.1 | hypothetical protein | - |
| ACB354_RS03830 (ACB354_03830) | - | 704301..704441 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| ACB354_RS03835 (ACB354_03835) | - | 704450..704656 (+) | 207 | WP_002990074.1 | hypothetical protein | - |
| ACB354_RS03840 (ACB354_03840) | - | 704712..705041 (+) | 330 | WP_010922207.1 | hypothetical protein | - |
| ACB354_RS03845 (ACB354_03845) | - | 705044..705970 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| ACB354_RS03850 (ACB354_03850) | - | 705967..706167 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| ACB354_RS03855 (ACB354_03855) | - | 706160..706957 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACB354_RS03860 (ACB354_03860) | - | 707322..707717 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| ACB354_RS03865 (ACB354_03865) | - | 707714..709060 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| ACB354_RS03870 (ACB354_03870) | - | 709071..709403 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| ACB354_RS03875 (ACB354_03875) | - | 709400..709912 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| ACB354_RS03880 (ACB354_03880) | - | 709948..710265 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| ACB354_RS03885 (ACB354_03885) | - | 710262..710417 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| ACB354_RS03890 (ACB354_03890) | - | 710414..710665 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| ACB354_RS03895 (ACB354_03895) | - | 710741..711160 (+) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| ACB354_RS03900 (ACB354_03900) | - | 711268..711612 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| ACB354_RS03905 (ACB354_03905) | - | 711760..712116 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| ACB354_RS03910 (ACB354_03910) | - | 712113..713381 (+) | 1269 | WP_011184740.1 | phage portal protein | - |
| ACB354_RS03915 (ACB354_03915) | - | 713374..714867 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| ACB354_RS03920 (ACB354_03920) | - | 714873..715097 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| ACB354_RS03925 (ACB354_03925) | - | 715174..715326 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| ACB354_RS03930 (ACB354_03930) | - | 715319..715585 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| ACB354_RS03935 (ACB354_03935) | - | 715587..715802 (+) | 216 | WP_011106704.1 | hypothetical protein | - |
| ACB354_RS03940 (ACB354_03940) | - | 715884..717299 (+) | 1416 | WP_011054685.1 | terminase | - |
| ACB354_RS03945 (ACB354_03945) | - | 717380..717841 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| ACB354_RS03950 (ACB354_03950) | - | 717866..718777 (+) | 912 | WP_011054683.1 | phage major capsid protein | - |
| ACB354_RS03955 (ACB354_03955) | - | 718777..718977 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| ACB354_RS03960 (ACB354_03960) | - | 718987..719409 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ACB354_RS03965 (ACB354_03965) | - | 719369..719707 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| ACB354_RS03970 (ACB354_03970) | - | 719700..719936 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| ACB354_RS03975 (ACB354_03975) | - | 719937..720272 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| ACB354_RS03980 (ACB354_03980) | - | 720288..720878 (+) | 591 | WP_011054679.1 | hypothetical protein | - |
| ACB354_RS03985 (ACB354_03985) | - | 720889..721152 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| ACB354_RS03990 (ACB354_03990) | - | 721167..721538 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| ACB354_RS03995 (ACB354_03995) | - | 721538..723904 (+) | 2367 | Protein_726 | hypothetical protein | - |
| ACB354_RS04000 (ACB354_04000) | - | 723901..724596 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| ACB354_RS04005 (ACB354_04005) | - | 724578..726551 (+) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| ACB354_RS04010 (ACB354_04010) | - | 726551..727660 (+) | 1110 | WP_011184734.1 | hyaluronoglucosaminidase | - |
| ACB354_RS04015 (ACB354_04015) | - | 727675..729486 (+) | 1812 | Protein_730 | gp58-like family protein | - |
| ACB354_RS04020 (ACB354_04020) | - | 729470..729946 (+) | 477 | Protein_731 | DUF1617 family protein | - |
| ACB354_RS04025 (ACB354_04025) | - | 729906..730517 (+) | 612 | WP_371399122.1 | DUF1366 domain-containing protein | - |
| ACB354_RS04030 (ACB354_04030) | - | 730527..730982 (+) | 456 | WP_011184730.1 | phage holin family protein | - |
| ACB354_RS04035 (ACB354_04035) | - | 731100..731309 (+) | 210 | WP_011184729.1 | hypothetical protein | - |
| ACB354_RS04040 (ACB354_04040) | - | 731348..732979 (+) | 1632 | Protein_735 | IS1182 family transposase | - |
| ACB354_RS04045 (ACB354_04045) | - | 733139..733414 (+) | 276 | WP_371399129.1 | SH3 domain-containing protein | - |
| ACB354_RS04050 (ACB354_04050) | speC | 733483..734190 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| ACB354_RS04055 (ACB354_04055) | mf2 | 734301..735059 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| ACB354_RS04060 (ACB354_04060) | prx | 735299..735481 (+) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=1037040 ACB354_RS04060 WP_011184726.1 735299..735481(+) (prx) [Streptococcus pyogenes strain Isolate 28]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1037040 ACB354_RS04060 WP_011184726.1 735299..735481(+) (prx) [Streptococcus pyogenes strain Isolate 28]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |