Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB329_RS05910 | Genome accession | NZ_CP167003 |
| Coordinates | 1168866..1169048 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 29 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1168866..1203892 | 1168866..1169048 | within | 0 |
Gene organization within MGE regions
Location: 1168866..1203892
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB329_RS05910 (ACB329_05915) | prx | 1168866..1169048 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| ACB329_RS05915 (ACB329_05920) | sda3 | 1169287..1170087 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| ACB329_RS05920 (ACB329_05925) | - | 1170863..1172068 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| ACB329_RS05925 (ACB329_05930) | - | 1172184..1172411 (-) | 228 | WP_003058873.1 | phage holin | - |
| ACB329_RS05930 (ACB329_05935) | - | 1172408..1172683 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| ACB329_RS05935 (ACB329_05940) | - | 1172693..1173310 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| ACB329_RS05940 (ACB329_05945) | - | 1173307..1173744 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| ACB329_RS05945 (ACB329_05950) | - | 1173756..1175624 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| ACB329_RS05950 (ACB329_05955) | - | 1175621..1176316 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| ACB329_RS05955 (ACB329_05960) | - | 1176313..1178670 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| ACB329_RS05960 (ACB329_05965) | - | 1178670..1179041 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| ACB329_RS05965 (ACB329_05970) | - | 1179056..1179319 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| ACB329_RS05970 (ACB329_05975) | - | 1179330..1179923 (-) | 594 | WP_010922456.1 | tail protein | - |
| ACB329_RS05975 (ACB329_05980) | - | 1179935..1180270 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| ACB329_RS05980 (ACB329_05985) | - | 1180271..1180507 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| ACB329_RS05985 (ACB329_05990) | - | 1180500..1180838 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| ACB329_RS05990 (ACB329_05995) | - | 1180798..1181220 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ACB329_RS05995 (ACB329_06000) | - | 1181230..1181430 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| ACB329_RS06000 (ACB329_06005) | - | 1181430..1182341 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| ACB329_RS06005 (ACB329_06010) | - | 1182366..1182827 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| ACB329_RS06010 (ACB329_06015) | - | 1182908..1184323 (-) | 1416 | WP_011285619.1 | terminase | - |
| ACB329_RS06015 (ACB329_06020) | - | 1184433..1184699 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| ACB329_RS06020 (ACB329_06025) | - | 1184692..1184871 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| ACB329_RS06025 (ACB329_06030) | - | 1184921..1185145 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| ACB329_RS06030 (ACB329_06035) | - | 1185151..1186644 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| ACB329_RS06035 (ACB329_06040) | - | 1186637..1187905 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| ACB329_RS06040 (ACB329_06045) | - | 1187902..1188258 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| ACB329_RS06045 (ACB329_06050) | - | 1188407..1188751 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| ACB329_RS06050 (ACB329_06055) | - | 1188860..1189279 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| ACB329_RS06055 (ACB329_06060) | - | 1189547..1190182 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| ACB329_RS06060 (ACB329_06065) | - | 1190184..1190453 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| ACB329_RS06065 (ACB329_06070) | - | 1190537..1191049 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| ACB329_RS06070 (ACB329_06075) | - | 1191046..1191387 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| ACB329_RS06075 (ACB329_06080) | - | 1191565..1191732 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| ACB329_RS06080 (ACB329_06085) | - | 1191742..1192539 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACB329_RS06085 (ACB329_06090) | - | 1192536..1193465 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| ACB329_RS06090 (ACB329_06095) | - | 1193468..1193797 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| ACB329_RS06095 (ACB329_06100) | - | 1193853..1194059 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| ACB329_RS06100 (ACB329_06105) | - | 1194068..1194208 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| ACB329_RS06105 (ACB329_06110) | - | 1194205..1194438 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| ACB329_RS06110 (ACB329_06115) | - | 1194419..1194808 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| ACB329_RS06115 (ACB329_06120) | - | 1194968..1195207 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| ACB329_RS06120 (ACB329_06125) | - | 1195307..1195492 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| ACB329_RS06125 (ACB329_06130) | - | 1195494..1195805 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| ACB329_RS06130 (ACB329_06135) | - | 1195883..1196068 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| ACB329_RS06135 (ACB329_06140) | - | 1196235..1196474 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| ACB329_RS06140 (ACB329_06145) | - | 1196616..1197422 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| ACB329_RS06145 (ACB329_06150) | - | 1197357..1197623 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| ACB329_RS06150 (ACB329_06155) | - | 1197655..1198371 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| ACB329_RS06155 (ACB329_06160) | - | 1198383..1198574 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| ACB329_RS06160 (ACB329_06165) | - | 1199210..1199305 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| ACB329_RS06165 (ACB329_06170) | - | 1199728..1200075 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| ACB329_RS06170 (ACB329_06175) | - | 1200079..1200459 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB329_RS06175 (ACB329_06180) | - | 1200471..1200737 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| ACB329_RS06180 (ACB329_06185) | - | 1200861..1202003 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ACB329_RS06185 (ACB329_06190) | - | 1202093..1202368 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ACB329_RS06190 (ACB329_06195) | - | 1202467..1203054 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| ACB329_RS06195 (ACB329_06200) | - | 1203032..1203874 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1036983 ACB329_RS05910 WP_011017964.1 1168866..1169048(-) (prx) [Streptococcus pyogenes strain Isolate 29]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1036983 ACB329_RS05910 WP_011017964.1 1168866..1169048(-) (prx) [Streptococcus pyogenes strain Isolate 29]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |