Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB341_RS07180 | Genome accession | NZ_CP167001 |
| Coordinates | 1409922..1410101 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain Isolate 31 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1409922..1450538 | 1409922..1410101 | within | 0 |
Gene organization within MGE regions
Location: 1409922..1450538
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB341_RS07180 (ACB341_07185) | prx | 1409922..1410101 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ACB341_RS07185 (ACB341_07190) | sda1 | 1410340..1411512 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ACB341_RS07190 (ACB341_07195) | - | 1411628..1412824 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ACB341_RS07195 (ACB341_07200) | - | 1412935..1413120 (-) | 186 | WP_002988802.1 | holin | - |
| ACB341_RS07200 (ACB341_07205) | - | 1413117..1413416 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ACB341_RS07205 (ACB341_07210) | - | 1413427..1414047 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ACB341_RS07210 (ACB341_07215) | - | 1414050..1414211 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ACB341_RS07215 (ACB341_07220) | - | 1414220..1416127 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| ACB341_RS07220 (ACB341_07225) | - | 1416138..1416773 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| ACB341_RS07225 (ACB341_07230) | - | 1416773..1417828 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ACB341_RS07230 (ACB341_07235) | - | 1417825..1419807 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ACB341_RS07235 (ACB341_07240) | - | 1419817..1420659 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ACB341_RS07240 (ACB341_07245) | - | 1420671..1425053 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ACB341_RS07245 (ACB341_07250) | - | 1425068..1425301 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ACB341_RS07250 (ACB341_07255) | - | 1425376..1425831 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ACB341_RS07255 (ACB341_07260) | - | 1425885..1426484 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ACB341_RS07260 (ACB341_07265) | - | 1426496..1426855 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| ACB341_RS07265 (ACB341_07270) | - | 1426859..1427203 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACB341_RS07270 (ACB341_07275) | - | 1427200..1427478 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ACB341_RS07275 (ACB341_07280) | - | 1427489..1427845 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ACB341_RS07280 (ACB341_07285) | - | 1427857..1428744 (-) | 888 | WP_322794628.1 | phage capsid protein | - |
| ACB341_RS07285 (ACB341_07290) | - | 1428757..1429326 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ACB341_RS07290 (ACB341_07295) | - | 1429482..1429748 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ACB341_RS07295 (ACB341_07300) | - | 1429751..1429939 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ACB341_RS07300 (ACB341_07305) | - | 1429970..1431415 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ACB341_RS07305 (ACB341_07310) | - | 1431375..1432907 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| ACB341_RS07310 (ACB341_07315) | - | 1432923..1434200 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ACB341_RS07315 (ACB341_07320) | - | 1434190..1434642 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ACB341_RS07320 (ACB341_07325) | - | 1434732..1435148 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ACB341_RS07325 (ACB341_07330) | - | 1435145..1435336 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ACB341_RS07330 (ACB341_07335) | - | 1435326..1436177 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| ACB341_RS07335 (ACB341_07340) | - | 1436186..1436452 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ACB341_RS07340 (ACB341_07345) | - | 1436449..1436616 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ACB341_RS07345 (ACB341_07350) | - | 1436617..1437939 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ACB341_RS07350 (ACB341_07355) | - | 1437936..1438211 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ACB341_RS07355 (ACB341_07360) | - | 1438598..1440982 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| ACB341_RS07360 (ACB341_07365) | - | 1440987..1442909 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ACB341_RS07365 (ACB341_07370) | - | 1442952..1443509 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ACB341_RS07370 (ACB341_07375) | - | 1443520..1443918 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ACB341_RS07375 (ACB341_07380) | - | 1443922..1445076 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ACB341_RS07380 (ACB341_07385) | - | 1445076..1445375 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ACB341_RS07385 (ACB341_07390) | - | 1445463..1445666 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ACB341_RS07390 (ACB341_07395) | - | 1445812..1446198 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ACB341_RS07395 (ACB341_07400) | - | 1446195..1446398 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ACB341_RS07400 (ACB341_07405) | - | 1446391..1446561 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ACB341_RS07405 (ACB341_07410) | - | 1446558..1446833 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ACB341_RS07410 (ACB341_07415) | - | 1446895..1447110 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ACB341_RS07415 (ACB341_07420) | - | 1447158..1447571 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ACB341_RS07420 (ACB341_07425) | - | 1447552..1447707 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ACB341_RS07425 (ACB341_07430) | - | 1448033..1448383 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| ACB341_RS07430 (ACB341_07435) | - | 1448397..1448780 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB341_RS07435 (ACB341_07440) | - | 1448791..1449342 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ACB341_RS07440 (ACB341_07445) | - | 1449459..1450538 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=1036877 ACB341_RS07180 WP_002988813.1 1409922..1410101(-) (prx) [Streptococcus pyogenes strain Isolate 31]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1036877 ACB341_RS07180 WP_002988813.1 1409922..1410101(-) (prx) [Streptococcus pyogenes strain Isolate 31]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |