Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB341_RS05910 | Genome accession | NZ_CP167001 |
| Coordinates | 1170245..1170427 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 31 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1170245..1205255 | 1170245..1170427 | within | 0 |
Gene organization within MGE regions
Location: 1170245..1205255
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB341_RS05910 (ACB341_05915) | prx | 1170245..1170427 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| ACB341_RS05915 (ACB341_05920) | sda3 | 1170666..1171466 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| ACB341_RS05920 (ACB341_05925) | - | 1171737..1172171 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| ACB341_RS05925 (ACB341_05930) | - | 1172241..1173446 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| ACB341_RS05930 (ACB341_05935) | - | 1173562..1173789 (-) | 228 | WP_003058873.1 | phage holin | - |
| ACB341_RS05935 (ACB341_05940) | - | 1173786..1174061 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| ACB341_RS05940 (ACB341_05945) | - | 1174071..1174688 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| ACB341_RS05945 (ACB341_05950) | - | 1174685..1175122 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| ACB341_RS05950 (ACB341_05955) | - | 1175134..1177002 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| ACB341_RS05955 (ACB341_05960) | - | 1176999..1177694 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| ACB341_RS05960 (ACB341_05965) | - | 1177691..1180048 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| ACB341_RS05965 (ACB341_05970) | - | 1180048..1180419 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| ACB341_RS05970 (ACB341_05975) | - | 1180434..1180697 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| ACB341_RS05975 (ACB341_05980) | - | 1180708..1181301 (-) | 594 | WP_010922456.1 | tail protein | - |
| ACB341_RS05980 (ACB341_05985) | - | 1181313..1181648 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| ACB341_RS05985 (ACB341_05990) | - | 1181649..1181885 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| ACB341_RS05990 (ACB341_05995) | - | 1181878..1182216 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| ACB341_RS05995 (ACB341_06000) | - | 1182176..1182598 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ACB341_RS06000 (ACB341_06005) | - | 1182608..1182808 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| ACB341_RS06005 (ACB341_06010) | - | 1182808..1183719 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| ACB341_RS06010 (ACB341_06015) | - | 1183744..1184205 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| ACB341_RS06015 (ACB341_06020) | - | 1184286..1185701 (-) | 1416 | WP_011285619.1 | terminase | - |
| ACB341_RS06020 (ACB341_06025) | - | 1185811..1186077 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| ACB341_RS06025 (ACB341_06030) | - | 1186070..1186249 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| ACB341_RS06030 (ACB341_06035) | - | 1186299..1186523 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| ACB341_RS06035 (ACB341_06040) | - | 1186529..1188022 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| ACB341_RS06040 (ACB341_06045) | - | 1188015..1189283 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| ACB341_RS06045 (ACB341_06050) | - | 1189280..1189636 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| ACB341_RS06050 (ACB341_06055) | - | 1189785..1190129 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| ACB341_RS06055 (ACB341_06060) | - | 1190238..1190657 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| ACB341_RS06060 (ACB341_06065) | - | 1190925..1191560 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| ACB341_RS06065 (ACB341_06070) | - | 1191562..1191831 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| ACB341_RS06070 (ACB341_06075) | - | 1191915..1192427 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| ACB341_RS06075 (ACB341_06080) | - | 1192424..1192765 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| ACB341_RS06080 (ACB341_06085) | - | 1192943..1193110 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| ACB341_RS06085 (ACB341_06090) | - | 1193120..1193917 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACB341_RS06090 (ACB341_06095) | - | 1193914..1194843 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| ACB341_RS06095 (ACB341_06100) | - | 1194846..1195175 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| ACB341_RS06100 (ACB341_06105) | - | 1195231..1195437 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| ACB341_RS06105 (ACB341_06110) | - | 1195446..1195586 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| ACB341_RS06110 (ACB341_06115) | - | 1195583..1195816 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| ACB341_RS06115 (ACB341_06120) | - | 1195797..1196186 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| ACB341_RS06120 (ACB341_06125) | - | 1196331..1196570 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| ACB341_RS06125 (ACB341_06130) | - | 1196670..1196855 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| ACB341_RS06130 (ACB341_06135) | - | 1196857..1197168 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| ACB341_RS06135 (ACB341_06140) | - | 1197246..1197431 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| ACB341_RS06140 (ACB341_06145) | - | 1197598..1197837 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| ACB341_RS06145 (ACB341_06150) | - | 1197979..1198785 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| ACB341_RS06150 (ACB341_06155) | - | 1198720..1198986 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| ACB341_RS06155 (ACB341_06160) | - | 1199018..1199734 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| ACB341_RS06160 (ACB341_06165) | - | 1199746..1199937 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| ACB341_RS06165 (ACB341_06170) | - | 1200573..1200668 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| ACB341_RS06170 (ACB341_06175) | - | 1201091..1201438 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| ACB341_RS06175 (ACB341_06180) | - | 1201442..1201822 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB341_RS06180 (ACB341_06185) | - | 1201834..1202100 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| ACB341_RS06185 (ACB341_06190) | - | 1202224..1203366 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ACB341_RS06190 (ACB341_06195) | - | 1203456..1203731 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ACB341_RS06195 (ACB341_06200) | - | 1203830..1204417 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| ACB341_RS06200 (ACB341_06205) | - | 1204395..1205237 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1036870 ACB341_RS05910 WP_011017964.1 1170245..1170427(-) (prx) [Streptococcus pyogenes strain Isolate 31]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1036870 ACB341_RS05910 WP_011017964.1 1170245..1170427(-) (prx) [Streptococcus pyogenes strain Isolate 31]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |