Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB336_RS07175 | Genome accession | NZ_CP167000 |
| Coordinates | 1408302..1408481 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain Isolate 33 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408302..1448918 | 1408302..1408481 | within | 0 |
Gene organization within MGE regions
Location: 1408302..1448918
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB336_RS07175 (ACB336_07180) | prx | 1408302..1408481 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ACB336_RS07180 (ACB336_07185) | sda1 | 1408720..1409892 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ACB336_RS07185 (ACB336_07190) | - | 1410008..1411204 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ACB336_RS07190 (ACB336_07195) | - | 1411315..1411500 (-) | 186 | WP_002988802.1 | holin | - |
| ACB336_RS07195 (ACB336_07200) | - | 1411497..1411796 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ACB336_RS07200 (ACB336_07205) | - | 1411807..1412427 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ACB336_RS07205 (ACB336_07210) | - | 1412430..1412591 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ACB336_RS07210 (ACB336_07215) | - | 1412600..1414507 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| ACB336_RS07215 (ACB336_07220) | - | 1414518..1415153 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| ACB336_RS07220 (ACB336_07225) | - | 1415153..1416208 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ACB336_RS07225 (ACB336_07230) | - | 1416205..1418187 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ACB336_RS07230 (ACB336_07235) | - | 1418197..1419039 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ACB336_RS07235 (ACB336_07240) | - | 1419051..1423433 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ACB336_RS07240 (ACB336_07245) | - | 1423448..1423681 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ACB336_RS07245 (ACB336_07250) | - | 1423756..1424211 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ACB336_RS07250 (ACB336_07255) | - | 1424265..1424864 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ACB336_RS07255 (ACB336_07260) | - | 1424876..1425235 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| ACB336_RS07260 (ACB336_07265) | - | 1425239..1425583 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACB336_RS07265 (ACB336_07270) | - | 1425580..1425858 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ACB336_RS07270 (ACB336_07275) | - | 1425869..1426225 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ACB336_RS07275 (ACB336_07280) | - | 1426237..1427124 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| ACB336_RS07280 (ACB336_07285) | - | 1427137..1427706 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ACB336_RS07285 (ACB336_07290) | - | 1427862..1428128 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ACB336_RS07290 (ACB336_07295) | - | 1428131..1428319 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ACB336_RS07295 (ACB336_07300) | - | 1428350..1429795 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ACB336_RS07300 (ACB336_07305) | - | 1429755..1431287 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| ACB336_RS07305 (ACB336_07310) | - | 1431303..1432580 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ACB336_RS07310 (ACB336_07315) | - | 1432570..1433022 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ACB336_RS07315 (ACB336_07320) | - | 1433112..1433528 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ACB336_RS07320 (ACB336_07325) | - | 1433525..1433716 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ACB336_RS07325 (ACB336_07330) | - | 1433706..1434557 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| ACB336_RS07330 (ACB336_07335) | - | 1434566..1434832 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ACB336_RS07335 (ACB336_07340) | - | 1434829..1434996 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ACB336_RS07340 (ACB336_07345) | - | 1434997..1436319 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ACB336_RS07345 (ACB336_07350) | - | 1436316..1436591 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ACB336_RS07350 (ACB336_07355) | - | 1436978..1439362 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| ACB336_RS07355 (ACB336_07360) | - | 1439367..1441289 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ACB336_RS07360 (ACB336_07365) | - | 1441332..1441889 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ACB336_RS07365 (ACB336_07370) | - | 1441900..1442298 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ACB336_RS07370 (ACB336_07375) | - | 1442302..1443456 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ACB336_RS07375 (ACB336_07380) | - | 1443456..1443755 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ACB336_RS07380 (ACB336_07385) | - | 1443843..1444046 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ACB336_RS07385 (ACB336_07390) | - | 1444192..1444578 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ACB336_RS07390 (ACB336_07395) | - | 1444575..1444778 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ACB336_RS07395 (ACB336_07400) | - | 1444771..1444941 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ACB336_RS07400 (ACB336_07405) | - | 1444938..1445213 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ACB336_RS07405 (ACB336_07410) | - | 1445275..1445490 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ACB336_RS07410 (ACB336_07415) | - | 1445538..1445951 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ACB336_RS07415 (ACB336_07420) | - | 1445932..1446087 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ACB336_RS07420 (ACB336_07425) | - | 1446413..1446763 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| ACB336_RS07425 (ACB336_07430) | - | 1446777..1447160 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB336_RS07430 (ACB336_07435) | - | 1447171..1447722 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ACB336_RS07435 (ACB336_07440) | - | 1447839..1448918 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=1036821 ACB336_RS07175 WP_002988813.1 1408302..1408481(-) (prx) [Streptococcus pyogenes strain Isolate 33]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1036821 ACB336_RS07175 WP_002988813.1 1408302..1408481(-) (prx) [Streptococcus pyogenes strain Isolate 33]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |