Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB336_RS05060 | Genome accession | NZ_CP167000 |
| Coordinates | 1006885..1007073 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 33 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999301..1045611 | 1006885..1007073 | within | 0 |
Gene organization within MGE regions
Location: 999301..1045611
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB336_RS05025 (ACB336_05030) | pfkA | 999301..1000314 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| ACB336_RS05030 (ACB336_05035) | - | 1000394..1003504 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| ACB336_RS05035 (ACB336_05040) | - | 1003689..1004060 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| ACB336_RS05040 (ACB336_05045) | - | 1004060..1004758 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ACB336_RS05045 (ACB336_05050) | - | 1004768..1005553 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| ACB336_RS05050 (ACB336_05055) | - | 1005680..1006294 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| ACB336_RS05060 (ACB336_05065) | prx | 1006885..1007073 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| ACB336_RS05065 (ACB336_05070) | speA | 1007293..1008048 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| ACB336_RS05070 (ACB336_05075) | - | 1008170..1008829 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| ACB336_RS05075 (ACB336_05080) | - | 1008829..1009050 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| ACB336_RS05080 (ACB336_05085) | - | 1009060..1009833 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| ACB336_RS05085 (ACB336_05090) | - | 1009844..1010446 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| ACB336_RS05090 (ACB336_05095) | - | 1010458..1011222 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| ACB336_RS05095 (ACB336_05100) | - | 1011224..1011556 (-) | 333 | WP_011285562.1 | phage holin | - |
| ACB336_RS05100 (ACB336_05105) | - | 1011556..1011879 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| ACB336_RS05105 (ACB336_05110) | - | 1011893..1012015 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| ACB336_RS05110 (ACB336_05115) | - | 1012029..1012376 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| ACB336_RS05115 (ACB336_05120) | - | 1012387..1014249 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| ACB336_RS05120 (ACB336_05125) | - | 1014254..1017694 (-) | 3441 | Protein_959 | glucosaminidase domain-containing protein | - |
| ACB336_RS05125 (ACB336_05130) | - | 1017695..1019179 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| ACB336_RS05130 (ACB336_05135) | - | 1019180..1020985 (-) | 1806 | WP_011054802.1 | tail protein | - |
| ACB336_RS05135 (ACB336_05140) | - | 1020978..1021436 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| ACB336_RS05140 (ACB336_05145) | - | 1021409..1021726 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| ACB336_RS05145 (ACB336_05150) | - | 1021739..1022245 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| ACB336_RS05150 (ACB336_05155) | - | 1022257..1022667 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| ACB336_RS05155 (ACB336_05160) | - | 1022669..1023064 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| ACB336_RS05160 (ACB336_05165) | - | 1023061..1023372 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| ACB336_RS05165 (ACB336_05170) | - | 1023369..1023713 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| ACB336_RS05170 (ACB336_05175) | - | 1023727..1024020 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| ACB336_RS05175 (ACB336_05180) | - | 1024033..1024923 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| ACB336_RS05180 (ACB336_05185) | - | 1024942..1025511 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| ACB336_RS05185 (ACB336_05190) | - | 1025620..1025754 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| ACB336_RS05190 (ACB336_05195) | - | 1025756..1026025 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| ACB336_RS05195 (ACB336_05200) | - | 1026032..1026940 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| ACB336_RS05200 (ACB336_05205) | - | 1026909..1028234 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| ACB336_RS05205 (ACB336_05210) | - | 1028234..1029508 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| ACB336_RS05210 (ACB336_05215) | - | 1029498..1029878 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| ACB336_RS05215 (ACB336_05220) | - | 1030488..1030922 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB336_RS05220 (ACB336_05225) | - | 1031208..1031474 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| ACB336_RS05225 (ACB336_05230) | - | 1031471..1031995 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| ACB336_RS05230 (ACB336_05235) | - | 1031998..1032630 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ACB336_RS05235 (ACB336_05240) | - | 1032632..1032916 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| ACB336_RS05240 (ACB336_05245) | - | 1032913..1033083 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| ACB336_RS05245 (ACB336_05250) | - | 1033080..1033316 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| ACB336_RS05250 (ACB336_05255) | - | 1033316..1033561 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| ACB336_RS05255 (ACB336_05260) | - | 1033558..1033914 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| ACB336_RS05260 (ACB336_05265) | - | 1033911..1034351 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACB336_RS05265 (ACB336_05270) | - | 1034351..1034554 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| ACB336_RS05270 (ACB336_05275) | ssb | 1034560..1034985 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| ACB336_RS05275 (ACB336_05280) | - | 1034978..1035652 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| ACB336_RS05280 (ACB336_05285) | - | 1035653..1036135 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| ACB336_RS05285 (ACB336_05290) | - | 1036157..1036411 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| ACB336_RS05290 (ACB336_05295) | - | 1036392..1036745 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| ACB336_RS05295 (ACB336_05300) | - | 1036886..1037668 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| ACB336_RS05300 (ACB336_05305) | - | 1037655..1038485 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACB336_RS05305 (ACB336_05310) | - | 1038499..1038687 (-) | 189 | Protein_996 | XRE family transcriptional regulator | - |
| ACB336_RS05310 (ACB336_05315) | - | 1038921..1039160 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| ACB336_RS05315 (ACB336_05320) | - | 1039291..1039500 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| ACB336_RS05320 (ACB336_05325) | - | 1039610..1039810 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| ACB336_RS05325 (ACB336_05330) | - | 1039884..1040270 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| ACB336_RS05330 (ACB336_05335) | - | 1040259..1040468 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| ACB336_RS05335 (ACB336_05340) | - | 1040522..1041121 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| ACB336_RS05340 (ACB336_05345) | - | 1041151..1041309 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| ACB336_RS05345 (ACB336_05350) | - | 1041666..1042490 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| ACB336_RS05350 (ACB336_05355) | - | 1042526..1043419 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| ACB336_RS05355 (ACB336_05360) | - | 1043540..1044628 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| ACB336_RS05360 (ACB336_05365) | - | 1044991..1045611 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=1036810 ACB336_RS05060 WP_011285559.1 1006885..1007073(-) (prx) [Streptococcus pyogenes strain Isolate 33]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1036810 ACB336_RS05060 WP_011285559.1 1006885..1007073(-) (prx) [Streptococcus pyogenes strain Isolate 33]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |