Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB356_RS06655 | Genome accession | NZ_CP166998 |
| Coordinates | 1338239..1338418 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain Isolate 35 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1338239..1378856 | 1338239..1338418 | within | 0 |
Gene organization within MGE regions
Location: 1338239..1378856
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB356_RS06655 (ACB356_06655) | prx | 1338239..1338418 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ACB356_RS06660 (ACB356_06660) | sda1 | 1338657..1339829 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ACB356_RS06665 (ACB356_06665) | - | 1339945..1341141 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ACB356_RS06670 (ACB356_06670) | - | 1341252..1341437 (-) | 186 | WP_002988802.1 | holin | - |
| ACB356_RS06675 (ACB356_06675) | - | 1341434..1341733 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ACB356_RS06680 (ACB356_06680) | - | 1341744..1342364 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ACB356_RS06685 (ACB356_06685) | - | 1342367..1342528 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ACB356_RS06690 (ACB356_06690) | - | 1342537..1344444 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| ACB356_RS06695 (ACB356_06695) | - | 1344455..1345090 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| ACB356_RS06700 (ACB356_06700) | - | 1345090..1346145 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ACB356_RS06705 (ACB356_06705) | - | 1346142..1348124 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ACB356_RS06710 (ACB356_06710) | - | 1348134..1348976 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ACB356_RS06715 (ACB356_06715) | - | 1348988..1353370 (-) | 4383 | WP_371395725.1 | tape measure protein | - |
| ACB356_RS06720 (ACB356_06720) | - | 1353385..1353618 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ACB356_RS06725 (ACB356_06725) | - | 1353693..1354148 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ACB356_RS06730 (ACB356_06730) | - | 1354202..1354801 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ACB356_RS06735 (ACB356_06735) | - | 1354813..1355172 (-) | 360 | WP_371395727.1 | hypothetical protein | - |
| ACB356_RS06740 (ACB356_06740) | - | 1355176..1355520 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACB356_RS06745 (ACB356_06745) | - | 1355517..1355795 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ACB356_RS06750 (ACB356_06750) | - | 1355806..1356162 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ACB356_RS06755 (ACB356_06755) | - | 1356174..1357061 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| ACB356_RS06760 (ACB356_06760) | - | 1357074..1357643 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ACB356_RS06765 (ACB356_06765) | - | 1357799..1358065 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ACB356_RS06770 (ACB356_06770) | - | 1358068..1358256 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ACB356_RS06775 (ACB356_06775) | - | 1358287..1359732 (-) | 1446 | WP_371395729.1 | minor capsid protein | - |
| ACB356_RS06780 (ACB356_06780) | - | 1359692..1361224 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| ACB356_RS06785 (ACB356_06785) | - | 1361240..1362517 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ACB356_RS06790 (ACB356_06790) | - | 1362507..1362959 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ACB356_RS06795 (ACB356_06795) | - | 1363049..1363465 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ACB356_RS06800 (ACB356_06800) | - | 1363462..1363653 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ACB356_RS06805 (ACB356_06805) | - | 1363643..1364494 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| ACB356_RS06810 (ACB356_06810) | - | 1364503..1364769 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ACB356_RS06815 (ACB356_06815) | - | 1364766..1364933 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ACB356_RS06820 (ACB356_06820) | - | 1364934..1366256 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ACB356_RS06825 (ACB356_06825) | - | 1366253..1366528 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ACB356_RS06830 (ACB356_06830) | - | 1366915..1369299 (-) | 2385 | WP_346393453.1 | phage/plasmid primase, P4 family | - |
| ACB356_RS06835 (ACB356_06835) | - | 1369304..1371226 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ACB356_RS06840 (ACB356_06840) | - | 1371269..1371826 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ACB356_RS06845 (ACB356_06845) | - | 1371837..1372235 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ACB356_RS06850 (ACB356_06850) | - | 1372239..1373393 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ACB356_RS06855 (ACB356_06855) | - | 1373393..1373692 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ACB356_RS06860 (ACB356_06860) | - | 1373780..1373983 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ACB356_RS06865 (ACB356_06865) | - | 1374130..1374516 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ACB356_RS06870 (ACB356_06870) | - | 1374513..1374716 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ACB356_RS06875 (ACB356_06875) | - | 1374709..1374879 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ACB356_RS06880 (ACB356_06880) | - | 1374876..1375151 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ACB356_RS06885 (ACB356_06885) | - | 1375213..1375428 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ACB356_RS06890 (ACB356_06890) | - | 1375476..1375889 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ACB356_RS06895 (ACB356_06895) | - | 1375870..1376025 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ACB356_RS06900 (ACB356_06900) | - | 1376351..1376701 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| ACB356_RS06905 (ACB356_06905) | - | 1376715..1377098 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB356_RS06910 (ACB356_06910) | - | 1377109..1377660 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ACB356_RS06915 (ACB356_06915) | - | 1377777..1378856 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=1036718 ACB356_RS06655 WP_002988813.1 1338239..1338418(-) (prx) [Streptococcus pyogenes strain Isolate 35]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1036718 ACB356_RS06655 WP_002988813.1 1338239..1338418(-) (prx) [Streptococcus pyogenes strain Isolate 35]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |