Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | AB6M99_RS02100 | Genome accession | NZ_CP163513 |
| Coordinates | 410548..410742 (+) | Length | 64 a.a. |
| NCBI ID | WP_369351048.1 | Uniprot ID | - |
| Organism | Streptococcus hillyeri strain S23-3001-2 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 374976..415296 | 410548..410742 | within | 0 |
| IS/Tn | 411387..412502 | 410548..410742 | flank | 645 |
Gene organization within MGE regions
Location: 374976..415296
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB6M99_RS01825 (AB6M99_01825) | - | 374976..376073 (-) | 1098 | WP_369351003.1 | site-specific integrase | - |
| AB6M99_RS01830 (AB6M99_01830) | - | 376244..376822 (-) | 579 | WP_369351004.1 | Ltp family lipoprotein | - |
| AB6M99_RS01835 (AB6M99_01835) | - | 376870..377259 (-) | 390 | WP_369351005.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AB6M99_RS01840 (AB6M99_01840) | - | 377282..377641 (-) | 360 | WP_369351006.1 | helix-turn-helix domain-containing protein | - |
| AB6M99_RS01845 (AB6M99_01845) | - | 377927..378136 (+) | 210 | WP_369351007.1 | helix-turn-helix domain-containing protein | - |
| AB6M99_RS01850 (AB6M99_01850) | - | 378139..378273 (+) | 135 | WP_369351008.1 | hypothetical protein | - |
| AB6M99_RS01855 (AB6M99_01855) | - | 378270..378488 (+) | 219 | WP_369351009.1 | hypothetical protein | - |
| AB6M99_RS01860 (AB6M99_01860) | - | 378667..378942 (+) | 276 | WP_369351010.1 | hypothetical protein | - |
| AB6M99_RS01865 (AB6M99_01865) | - | 378971..379189 (+) | 219 | WP_369351011.1 | hypothetical protein | - |
| AB6M99_RS01870 (AB6M99_01870) | - | 379415..380320 (+) | 906 | WP_369351013.1 | DnaD domain protein | - |
| AB6M99_RS01875 (AB6M99_01875) | - | 380517..380978 (+) | 462 | WP_369351014.1 | class I SAM-dependent methyltransferase | - |
| AB6M99_RS01880 (AB6M99_01880) | - | 380988..381215 (+) | 228 | WP_369351015.1 | hypothetical protein | - |
| AB6M99_RS01885 (AB6M99_01885) | - | 381208..381525 (+) | 318 | WP_369351016.1 | hypothetical protein | - |
| AB6M99_RS01890 (AB6M99_01890) | - | 381491..381643 (+) | 153 | WP_369351017.1 | hypothetical protein | - |
| AB6M99_RS01895 (AB6M99_01895) | - | 381645..382001 (+) | 357 | WP_369351248.1 | DUF1372 family protein | - |
| AB6M99_RS01900 (AB6M99_01900) | - | 382229..382732 (+) | 504 | WP_369351018.1 | DUF1642 domain-containing protein | - |
| AB6M99_RS01905 (AB6M99_01905) | - | 382925..383305 (+) | 381 | WP_369351020.1 | YopX family protein | - |
| AB6M99_RS01910 (AB6M99_01910) | - | 383307..383615 (+) | 309 | WP_369351021.1 | YopX family protein | - |
| AB6M99_RS01915 (AB6M99_01915) | - | 383641..383859 (+) | 219 | WP_369351022.1 | hypothetical protein | - |
| AB6M99_RS01920 (AB6M99_01920) | - | 383903..384094 (+) | 192 | WP_369351023.1 | hypothetical protein | - |
| AB6M99_RS01925 (AB6M99_01925) | - | 384091..384426 (+) | 336 | WP_369351024.1 | hypothetical protein | - |
| AB6M99_RS01930 (AB6M99_01930) | - | 384427..384813 (+) | 387 | WP_369351026.1 | hypothetical protein | - |
| AB6M99_RS01935 (AB6M99_01935) | - | 384806..385060 (+) | 255 | WP_369351027.1 | hypothetical protein | - |
| AB6M99_RS01940 (AB6M99_01940) | - | 385057..385209 (+) | 153 | WP_183121682.1 | hypothetical protein | - |
| AB6M99_RS01945 (AB6M99_01945) | - | 385178..385393 (+) | 216 | WP_369351028.1 | hypothetical protein | - |
| AB6M99_RS01950 (AB6M99_01950) | - | 385396..385824 (+) | 429 | WP_369351187.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AB6M99_RS01955 (AB6M99_01955) | - | 385968..386534 (+) | 567 | WP_161979831.1 | site-specific integrase | - |
| AB6M99_RS01960 (AB6M99_01960) | - | 386696..387034 (+) | 339 | WP_162012512.1 | HNH endonuclease | - |
| AB6M99_RS01965 (AB6M99_01965) | - | 387174..388436 (+) | 1263 | WP_369351029.1 | hypothetical protein | - |
| AB6M99_RS01970 (AB6M99_01970) | - | 388429..389928 (+) | 1500 | WP_369351188.1 | hypothetical protein | - |
| AB6M99_RS01975 (AB6M99_01975) | - | 389934..390155 (+) | 222 | WP_369351030.1 | hypothetical protein | - |
| AB6M99_RS01980 (AB6M99_01980) | - | 390218..390352 (+) | 135 | WP_369350562.1 | hypothetical protein | - |
| AB6M99_RS01985 (AB6M99_01985) | - | 390333..390566 (+) | 234 | WP_369350561.1 | hypothetical protein | - |
| AB6M99_RS01990 (AB6M99_01990) | - | 390550..390825 (+) | 276 | WP_369351031.1 | hypothetical protein | - |
| AB6M99_RS01995 (AB6M99_01995) | - | 390836..391087 (+) | 252 | WP_369350404.1 | DUF6275 family protein | - |
| AB6M99_RS02000 (AB6M99_02000) | - | 391229..392644 (+) | 1416 | WP_369351032.1 | terminase | - |
| AB6M99_RS02005 (AB6M99_02005) | - | 392719..393165 (+) | 447 | WP_369351033.1 | DUF4355 domain-containing protein | - |
| AB6M99_RS02010 (AB6M99_02010) | - | 393182..394075 (+) | 894 | WP_369351034.1 | phage major capsid protein | - |
| AB6M99_RS02015 (AB6M99_02015) | - | 394077..394292 (+) | 216 | WP_369351035.1 | hypothetical protein | - |
| AB6M99_RS02020 (AB6M99_02020) | - | 394341..394739 (+) | 399 | WP_369351036.1 | phage Gp19/Gp15/Gp42 family protein | - |
| AB6M99_RS02025 (AB6M99_02025) | - | 394726..395064 (+) | 339 | WP_369351037.1 | hypothetical protein | - |
| AB6M99_RS02030 (AB6M99_02030) | - | 395057..395296 (+) | 240 | WP_162012500.1 | hypothetical protein | - |
| AB6M99_RS02035 (AB6M99_02035) | - | 395293..395628 (+) | 336 | WP_369351038.1 | hypothetical protein | - |
| AB6M99_RS02040 (AB6M99_02040) | - | 395638..396201 (+) | 564 | WP_369351039.1 | phage tail protein | - |
| AB6M99_RS02045 (AB6M99_02045) | - | 396201..396461 (+) | 261 | WP_369351040.1 | hypothetical protein | - |
| AB6M99_RS02050 (AB6M99_02050) | - | 396476..396862 (+) | 387 | WP_369351041.1 | DUF5361 domain-containing protein | - |
| AB6M99_RS02055 (AB6M99_02055) | - | 396852..399440 (+) | 2589 | WP_369351042.1 | phage tail protein | - |
| AB6M99_RS02060 (AB6M99_02060) | - | 399450..400136 (+) | 687 | WP_369351189.1 | phage tail protein | - |
| AB6M99_RS02065 (AB6M99_02065) | - | 400133..407530 (+) | 7398 | WP_369351043.1 | phage tail spike protein | - |
| AB6M99_RS02070 (AB6M99_02070) | - | 407540..407725 (+) | 186 | WP_369351044.1 | hypothetical protein | - |
| AB6M99_RS02075 (AB6M99_02075) | - | 407728..408090 (+) | 363 | WP_369351045.1 | hypothetical protein | - |
| AB6M99_RS02080 (AB6M99_02080) | - | 408104..408526 (+) | 423 | WP_369351046.1 | hypothetical protein | - |
| AB6M99_RS02085 (AB6M99_02085) | - | 408528..408731 (+) | 204 | WP_369351047.1 | phage holin | - |
| AB6M99_RS02090 (AB6M99_02090) | - | 408862..409599 (+) | 738 | Protein_390 | CHAP domain-containing protein | - |
| AB6M99_RS02095 (AB6M99_02095) | - | 409885..410400 (+) | 516 | WP_369350535.1 | hypothetical protein | - |
| AB6M99_RS02100 (AB6M99_02100) | prx | 410548..410742 (+) | 195 | WP_369351048.1 | Paratox | Regulator |
| AB6M99_RS02105 (AB6M99_02105) | - | 411387..412547 (-) | 1161 | WP_121836465.1 | ISAs1 family transposase | - |
| AB6M99_RS02110 (AB6M99_02110) | secA | 412673..415198 (+) | 2526 | WP_369351049.1 | preprotein translocase subunit SecA | - |
Sequence
Protein
Download Length: 64 a.a. Molecular weight: 7402.40 Da Isoelectric Point: 4.0808
>NTDB_id=1030279 AB6M99_RS02100 WP_369351048.1 410548..410742(+) (prx) [Streptococcus hillyeri strain S23-3001-2]
MLHYDELKQAVDDGYITGDKVNVVRKEGKLFDFVLPGELVRPWEVVISESVVDILDELRQQEDL
MLHYDELKQAVDDGYITGDKVNVVRKEGKLFDFVLPGELVRPWEVVISESVVDILDELRQQEDL
Nucleotide
Download Length: 195 bp
>NTDB_id=1030279 AB6M99_RS02100 WP_369351048.1 410548..410742(+) (prx) [Streptococcus hillyeri strain S23-3001-2]
ATGCTACATTATGACGAATTGAAACAAGCAGTAGATGACGGCTATATCACAGGGGACAAGGTCAATGTGGTAAGAAAAGA
GGGTAAGCTCTTTGATTTTGTCCTGCCAGGAGAGTTAGTGAGACCTTGGGAGGTGGTAATCTCTGAGAGCGTAGTAGACA
TATTGGACGAATTAAGACAACAAGAAGACCTCTGA
ATGCTACATTATGACGAATTGAAACAAGCAGTAGATGACGGCTATATCACAGGGGACAAGGTCAATGTGGTAAGAAAAGA
GGGTAAGCTCTTTGATTTTGTCCTGCCAGGAGAGTTAGTGAGACCTTGGGAGGTGGTAATCTCTGAGAGCGTAGTAGACA
TATTGGACGAATTAAGACAACAAGAAGACCTCTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
62.069 |
90.625 |
0.563 |
| prx | Streptococcus pyogenes MGAS8232 |
56.667 |
93.75 |
0.531 |
| prx | Streptococcus pyogenes MGAS315 |
58.621 |
90.625 |
0.531 |
| prx | Streptococcus pyogenes MGAS315 |
53.333 |
93.75 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
69.048 |
65.625 |
0.453 |
| prx | Streptococcus pyogenes MGAS315 |
65.854 |
64.063 |
0.422 |
| prx | Streptococcus pyogenes MGAS315 |
63.415 |
64.063 |
0.406 |