Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   AB3438_RS06270 Genome accession   NZ_CP162442
Coordinates   1288219..1288689 (+) Length   156 a.a.
NCBI ID   WP_000934765.1    Uniprot ID   -
Organism   Staphylococcus aureus strain TUM22188     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1262706..1318193 1288219..1288689 within 0


Gene organization within MGE regions


Location: 1262706..1318193
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3438_RS06110 (AB3438_06110) groES 1262706..1262990 (+) 285 WP_000917289.1 co-chaperone GroES -
  AB3438_RS06115 (AB3438_06115) groL 1263066..1264682 (+) 1617 WP_000240642.1 chaperonin GroEL -
  AB3438_RS06120 (AB3438_06120) - 1264777..1265323 (-) 547 Protein_1186 site-specific integrase -
  AB3438_RS06125 (AB3438_06125) - 1265384..1265596 (+) 213 WP_000128898.1 hypothetical protein -
  AB3438_RS06130 (AB3438_06130) - 1265593..1266183 (+) 591 WP_001293059.1 terminase small subunit -
  AB3438_RS06135 (AB3438_06135) - 1266500..1266937 (+) 438 WP_072419900.1 hypothetical protein -
  AB3438_RS06140 (AB3438_06140) - 1267043..1267486 (+) 444 WP_000022887.1 GNAT family N-acetyltransferase -
  AB3438_RS06145 (AB3438_06145) - 1268331..1269638 (-) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  AB3438_RS06150 (AB3438_06150) - 1269799..1270710 (+) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  AB3438_RS06155 (AB3438_06155) - 1270772..1271616 (+) 845 Protein_1193 class I SAM-dependent methyltransferase -
  AB3438_RS06160 (AB3438_06160) - 1271988..1273211 (-) 1224 WP_000206623.1 ArgE/DapE family deacylase -
  AB3438_RS06165 (AB3438_06165) lukH 1273647..1274699 (+) 1053 WP_000791417.1 bi-component leukocidin LukGH subunit H -
  AB3438_RS06170 (AB3438_06170) lukG 1274721..1275737 (+) 1017 WP_000595401.1 bi-component leukocidin LukGH subunit G -
  AB3438_RS06175 (AB3438_06175) sph 1275975..1276805 (-) 831 Protein_1197 sphingomyelin phosphodiesterase -
  AB3438_RS06180 (AB3438_06180) - 1276856..1277893 (-) 1038 WP_000857182.1 site-specific integrase -
  AB3438_RS06185 (AB3438_06185) sek 1277977..1278705 (-) 729 WP_000733771.1 staphylococcal enterotoxin type K -
  AB3438_RS06190 (AB3438_06190) seq 1278729..1279457 (-) 729 WP_001033320.1 staphylococcal enterotoxin type Q -
  AB3438_RS06195 (AB3438_06195) - 1279653..1280423 (-) 771 WP_001208482.1 S24 family peptidase -
  AB3438_RS06200 (AB3438_06200) - 1280582..1280806 (+) 225 WP_000338186.1 DUF739 family protein -
  AB3438_RS06205 (AB3438_06205) - 1280824..1281084 (+) 261 WP_000435341.1 transcriptional regulator -
  AB3438_RS06210 (AB3438_06210) - 1281108..1281647 (-) 540 WP_000351243.1 hypothetical protein -
  AB3438_RS06215 (AB3438_06215) - 1281704..1282453 (+) 750 WP_001148337.1 phage antirepressor KilAC domain-containing protein -
  AB3438_RS06220 (AB3438_06220) - 1282469..1282666 (+) 198 WP_001148861.1 hypothetical protein -
  AB3438_RS06225 (AB3438_06225) - 1282697..1282837 (+) 141 WP_000939496.1 hypothetical protein -
  AB3438_RS06230 (AB3438_06230) - 1282852..1283484 (-) 633 WP_000275058.1 hypothetical protein -
  AB3438_RS06235 (AB3438_06235) - 1283543..1283863 (+) 321 WP_001120197.1 DUF771 domain-containing protein -
  AB3438_RS06240 (AB3438_06240) - 1283860..1284021 (+) 162 WP_000066020.1 DUF1270 domain-containing protein -
  AB3438_RS06245 (AB3438_06245) - 1284114..1284374 (+) 261 WP_000291488.1 DUF1108 family protein -
  AB3438_RS06250 (AB3438_06250) - 1284383..1284646 (+) 264 WP_001205732.1 hypothetical protein -
  AB3438_RS06255 (AB3438_06255) - 1284643..1286598 (+) 1956 WP_064138715.1 AAA family ATPase -
  AB3438_RS06260 (AB3438_06260) - 1286600..1287520 (+) 921 WP_000138475.1 recombinase RecT -
  AB3438_RS06265 (AB3438_06265) - 1287601..1288218 (+) 618 WP_072353921.1 MBL fold metallo-hydrolase -
  AB3438_RS06270 (AB3438_06270) ssbA 1288219..1288689 (+) 471 WP_000934765.1 single-stranded DNA-binding protein Machinery gene
  AB3438_RS06275 (AB3438_06275) - 1288719..1289612 (+) 894 WP_000148328.1 DnaD domain-containing protein -
  AB3438_RS06280 (AB3438_06280) - 1289619..1289837 (+) 219 WP_000338527.1 hypothetical protein -
  AB3438_RS06285 (AB3438_06285) - 1289846..1290250 (+) 405 WP_000401978.1 RusA family crossover junction endodeoxyribonuclease -
  AB3438_RS06290 (AB3438_06290) - 1290263..1290514 (+) 252 Protein_1220 SA1788 family PVL leukocidin-associated protein -
  AB3438_RS06295 (AB3438_06295) - 1290499..1290594 (+) 96 Protein_1221 DUF1381 domain-containing protein -
  AB3438_RS06300 (AB3438_06300) - 1290591..1290740 (+) 150 WP_000595265.1 transcriptional activator RinB -
  AB3438_RS06305 (AB3438_06305) - 1290899..1291549 (+) 651 WP_001005262.1 hypothetical protein -
  AB3438_RS06310 (AB3438_06310) - 1291549..1291749 (+) 201 WP_001570807.1 DUF1514 family protein -
  AB3438_RS06315 (AB3438_06315) - 1291772..1292242 (+) 471 WP_000282755.1 hypothetical protein -
  AB3438_RS06320 (AB3438_06320) - 1292357..1292809 (+) 453 WP_000406191.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  AB3438_RS06325 (AB3438_06325) - 1292825..1293169 (+) 345 WP_000817289.1 HNH endonuclease -
  AB3438_RS06330 (AB3438_06330) - 1293298..1293765 (+) 468 WP_000919026.1 phage terminase small subunit P27 family -
  AB3438_RS06335 (AB3438_06335) - 1293768..1295462 (+) 1695 WP_000133304.1 terminase large subunit -
  AB3438_RS06340 (AB3438_06340) - 1295476..1295676 (+) 201 WP_000365299.1 hypothetical protein -
  AB3438_RS06345 (AB3438_06345) - 1295682..1296932 (+) 1251 WP_000511067.1 phage portal protein -
  AB3438_RS06350 (AB3438_06350) - 1296925..1297509 (+) 585 WP_000032525.1 HK97 family phage prohead protease -
  AB3438_RS06355 (AB3438_06355) - 1297597..1298844 (+) 1248 WP_000849950.1 phage major capsid protein -
  AB3438_RS06360 (AB3438_06360) - 1298880..1299038 (+) 159 WP_001252099.1 hypothetical protein -
  AB3438_RS06365 (AB3438_06365) - 1299047..1299379 (+) 333 WP_001177483.1 head-tail connector protein -
  AB3438_RS06370 (AB3438_06370) - 1299366..1299701 (+) 336 WP_000975314.1 head-tail adaptor protein -
  AB3438_RS06375 (AB3438_06375) - 1299701..1300078 (+) 378 WP_000501244.1 HK97-gp10 family putative phage morphogenesis protein -
  AB3438_RS06380 (AB3438_06380) - 1300075..1300455 (+) 381 WP_000611454.1 hypothetical protein -
  AB3438_RS06385 (AB3438_06385) - 1300456..1301409 (+) 954 WP_000570652.1 major tail protein -
  AB3438_RS06390 (AB3438_06390) - 1301474..1301920 (+) 447 WP_000442601.1 phage tail assembly chaperone G -
  AB3438_RS06395 (AB3438_06395) - 1301980..1302102 (+) 123 WP_000570353.1 hypothetical protein -
  AB3438_RS06400 (AB3438_06400) - 1302158..1306807 (+) 4650 WP_001133533.1 phage tail tape measure protein -
  AB3438_RS06405 (AB3438_06405) - 1306807..1308297 (+) 1491 WP_001154317.1 phage tail domain-containing protein -
  AB3438_RS06410 (AB3438_06410) - 1308313..1312095 (+) 3783 WP_117219101.1 phage tail spike protein -
  AB3438_RS06415 (AB3438_06415) - 1312088..1312240 (+) 153 WP_001000058.1 hypothetical protein -
  AB3438_RS06420 (AB3438_06420) - 1312286..1312573 (+) 288 WP_001262621.1 hypothetical protein -
  AB3438_RS06425 (AB3438_06425) - 1312629..1313003 (+) 375 WP_000340977.1 hypothetical protein -
  AB3438_RS06430 (AB3438_06430) sea 1313376..1314149 (+) 774 WP_000750412.1 staphylococcal enterotoxin type A -
  AB3438_RS06435 (AB3438_06435) pepG1 1314300..1314434 (+) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  AB3438_RS06440 (AB3438_06440) - 1314487..1314594 (-) 108 WP_031762631.1 hypothetical protein -
  AB3438_RS06445 (AB3438_06445) - 1314642..1314896 (+) 255 WP_000611512.1 phage holin -
  AB3438_RS06450 (AB3438_06450) - 1314908..1315663 (+) 756 WP_000861038.1 CHAP domain-containing protein -
  AB3438_RS06455 (AB3438_06455) sak 1315854..1316345 (+) 492 WP_000920038.1 staphylokinase -
  AB3438_RS06460 (AB3438_06460) - 1316996..1317331 (+) 336 Protein_1254 SH3 domain-containing protein -
  AB3438_RS06465 (AB3438_06465) scn 1317843..1318193 (+) 351 WP_000702263.1 complement inhibitor SCIN-A -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17673.54 Da        Isoelectric Point: 4.9627

>NTDB_id=1025633 AB3438_RS06270 WP_000934765.1 1288219..1288689(+) (ssbA) [Staphylococcus aureus strain TUM22188]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTDDNQQDLYQQQAQQTRGQSQYSNNKPVKDNPFANANCPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1025633 AB3438_RS06270 WP_000934765.1 1288219..1288689(+) (ssbA) [Staphylococcus aureus strain TUM22188]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTAAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAGATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATTGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

51.765

100

0.564

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Vibrio cholerae strain A1552

31.492

100

0.365

  ssb Neisseria meningitidis MC58

32.948

100

0.365

  ssb Neisseria gonorrhoeae MS11

32.948

100

0.365

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment