Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   AABJ81_RS14125 Genome accession   NZ_AP027745
Coordinates   2865767..2866396 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain 2017-01-4CC     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2856595..2893968 2865767..2866396 within 0


Gene organization within MGE regions


Location: 2856595..2893968
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABJ81_RS14075 (VEE70_26960) tusE 2856866..2857195 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  AABJ81_RS14080 (VEE70_26970) yccX 2857192..2857470 (-) 279 WP_000048252.1 acylphosphatase -
  AABJ81_RS14085 (VEE70_26980) rlmI 2857565..2858755 (+) 1191 WP_000116297.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  AABJ81_RS14090 (VEE70_26990) hspQ 2858813..2859130 (+) 318 WP_001295356.1 heat shock protein HspQ -
  AABJ81_RS14095 (VEE70_27000) yccU 2859175..2859588 (-) 414 WP_001301418.1 CoA-binding protein -
  AABJ81_RS14100 (VEE70_27010) yccT 2859761..2860423 (+) 663 WP_000847791.1 DUF2057 family protein -
  AABJ81_RS14105 (VEE70_27020) mgsA 2860519..2860977 (+) 459 WP_000424181.1 methylglyoxal synthase -
  AABJ81_RS14110 (VEE70_27030) helD 2861009..2863063 (-) 2055 WP_001295354.1 DNA helicase IV -
  AABJ81_RS14115 (VEE70_27040) yccF 2863186..2863632 (+) 447 WP_001261235.1 YccF domain-containing protein -
  AABJ81_RS14120 (VEE70_27050) yccS 2863642..2865804 (+) 2163 WP_000875061.1 YccS family putative transporter -
  AABJ81_RS14125 (VEE70_27060) sxy/tfoX 2865767..2866396 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  AABJ81_RS14130 (VEE70_27070) sulA 2866615..2867124 (+) 510 WP_001554869.1 SOS-induced cell division inhibitor SulA -
  AABJ81_RS14135 (VEE70_27090) ompA 2867481..2868521 (+) 1041 WP_000750416.1 porin OmpA -
  AABJ81_RS14140 (VEE70_27100) - 2868579..2869553 (-) 975 WP_012478345.1 IS30-like element ISApl1 family transposase -
  AABJ81_RS14145 (VEE70_27110) matP 2869669..2870121 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  AABJ81_RS14150 (VEE70_27120) ycbZ 2870307..2872067 (+) 1761 WP_000156518.1 Lon protease family protein -
  AABJ81_RS14155 (VEE70_27130) fabA 2872136..2872654 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  AABJ81_RS14160 (VEE70_27140) rmf 2872724..2872891 (-) 168 WP_000828648.1 ribosome modulation factor -
  AABJ81_RS14165 (VEE70_27150) pqiC 2873147..2873710 (-) 564 WP_000759118.1 membrane integrity-associated transporter subunit PqiC -
  AABJ81_RS14170 (VEE70_27160) pqiB 2873707..2875347 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  AABJ81_RS14175 (VEE70_27170) pqiA 2875352..2876605 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  AABJ81_RS14180 (VEE70_27180) uup 2876735..2878642 (-) 1908 WP_000053099.1 ABC transporter ATP-binding protein -
  AABJ81_RS14185 (VEE70_27190) rlmKL 2878654..2880762 (-) 2109 WP_001086539.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  AABJ81_RS14190 (VEE70_27200) ycbX 2881006..2882115 (+) 1110 WP_000212426.1 6-N-hydroxylaminopurine resistance protein YcbX -
  AABJ81_RS14195 (VEE70_27210) zapC 2882112..2882654 (-) 543 WP_001295353.1 cell division protein ZapC -
  AABJ81_RS14200 (VEE70_27220) pyrD 2882828..2883838 (-) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  AABJ81_RS14205 (VEE70_27240) ycbF 2883949..2884686 (-) 738 Protein_2781 fimbrial chaperone -
  AABJ81_RS14210 (VEE70_27250) ycbV 2884652..2885167 (-) 516 WP_000919497.1 fimbrial protein -
  AABJ81_RS14215 (VEE70_27260) ycbU 2885175..2885717 (-) 543 WP_023281170.1 fimbrial protein -
  AABJ81_RS14220 (VEE70_27270) elfG 2885729..2886799 (-) 1071 WP_001165668.1 fimbrial protein -
  AABJ81_RS14225 (VEE70_27280) elfC 2886790..2889390 (-) 2601 WP_000286333.1 fimbrial biogenesis usher protein -
  AABJ81_RS14230 (VEE70_27290) elfD 2889415..2890116 (-) 702 WP_016242023.1 molecular chaperone -
  AABJ81_RS14235 (VEE70_27300) elfA 2890199..2890738 (-) 540 WP_000750304.1 fimbrial protein -
  AABJ81_RS14240 (VEE70_27310) ssuE 2891094..2891669 (+) 576 WP_001263933.1 NADPH-dependent FMN reductase -
  AABJ81_RS14245 (VEE70_27320) ssuA 2891662..2892621 (+) 960 WP_023281169.1 aliphatic sulfonate ABC transporter substrate-binding protein SsuA -
  AABJ81_RS14250 (VEE70_27330) ssuD 2892618..2893763 (+) 1146 WP_000056007.1 FMNH2-dependent alkanesulfonate monooxygenase -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=102290 AABJ81_RS14125 WP_000839153.1 2865767..2866396(-) (sxy/tfoX) [Escherichia coli strain 2017-01-4CC]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=102290 AABJ81_RS14125 WP_000839153.1 2865767..2866396(-) (sxy/tfoX) [Escherichia coli strain 2017-01-4CC]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1


Multiple sequence alignment