Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABZ559_RS02125 | Genome accession | NZ_CP160400 |
| Coordinates | 422463..422657 (+) | Length | 64 a.a. |
| NCBI ID | WP_336384255.1 | Uniprot ID | - |
| Organism | Streptococcus sp. ZY19097 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 384644..422657 | 422463..422657 | within | 0 |
Gene organization within MGE regions
Location: 384644..422657
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABZ559_RS01865 (ABZ559_01865) | - | 384644..386077 (-) | 1434 | WP_367007082.1 | recombinase family protein | - |
| ABZ559_RS01870 (ABZ559_01870) | - | 386215..387186 (-) | 972 | WP_367007084.1 | SAP domain-containing protein | - |
| ABZ559_RS01875 (ABZ559_01875) | - | 387189..387893 (-) | 705 | WP_367007086.1 | XRE family transcriptional regulator | - |
| ABZ559_RS01880 (ABZ559_01880) | - | 388083..388283 (+) | 201 | WP_170239000.1 | helix-turn-helix transcriptional regulator | - |
| ABZ559_RS01885 (ABZ559_01885) | - | 388332..389057 (+) | 726 | WP_367007088.1 | phage antirepressor KilAC domain-containing protein | - |
| ABZ559_RS01890 (ABZ559_01890) | - | 389224..389427 (-) | 204 | WP_367007089.1 | hypothetical protein | - |
| ABZ559_RS01895 (ABZ559_01895) | - | 389535..389711 (+) | 177 | WP_367007091.1 | hypothetical protein | - |
| ABZ559_RS01900 (ABZ559_01900) | - | 389722..390081 (+) | 360 | WP_172015091.1 | helix-turn-helix domain-containing protein | - |
| ABZ559_RS01905 (ABZ559_01905) | - | 390339..390602 (+) | 264 | WP_367007093.1 | hypothetical protein | - |
| ABZ559_RS01910 (ABZ559_01910) | - | 390602..390862 (+) | 261 | WP_238708355.1 | hypothetical protein | - |
| ABZ559_RS01915 (ABZ559_01915) | - | 390874..391002 (+) | 129 | WP_256773381.1 | hypothetical protein | - |
| ABZ559_RS01920 (ABZ559_01920) | - | 391006..391185 (+) | 180 | WP_075105376.1 | hypothetical protein | - |
| ABZ559_RS01925 (ABZ559_01925) | - | 391182..392162 (+) | 981 | WP_367007094.1 | RecT family recombinase | - |
| ABZ559_RS01930 (ABZ559_01930) | - | 392162..392992 (+) | 831 | WP_367007096.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ABZ559_RS01935 (ABZ559_01935) | - | 392995..393321 (+) | 327 | WP_367007098.1 | hypothetical protein | - |
| ABZ559_RS01940 (ABZ559_01940) | - | 393311..393490 (+) | 180 | WP_367007100.1 | hypothetical protein | - |
| ABZ559_RS01945 (ABZ559_01945) | ssbA | 393592..394053 (+) | 462 | WP_061630269.1 | single-stranded DNA-binding protein | Machinery gene |
| ABZ559_RS01950 (ABZ559_01950) | - | 394063..394864 (+) | 802 | Protein_380 | DNA methyltransferase | - |
| ABZ559_RS01955 (ABZ559_01955) | - | 394854..395198 (+) | 345 | WP_336382906.1 | hypothetical protein | - |
| ABZ559_RS01960 (ABZ559_01960) | - | 395195..395614 (+) | 420 | WP_043035853.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ABZ559_RS01965 (ABZ559_01965) | - | 395611..395919 (+) | 309 | WP_367007102.1 | DUF1372 family protein | - |
| ABZ559_RS01970 (ABZ559_01970) | - | 396005..396367 (+) | 363 | WP_367007104.1 | YopX family protein | - |
| ABZ559_RS01975 (ABZ559_01975) | - | 396348..396527 (+) | 180 | WP_367007105.1 | hypothetical protein | - |
| ABZ559_RS01980 (ABZ559_01980) | - | 396556..396873 (+) | 318 | WP_367007106.1 | hypothetical protein | - |
| ABZ559_RS01985 (ABZ559_01985) | - | 396948..397370 (+) | 423 | WP_367007108.1 | DUF1492 domain-containing protein | - |
| ABZ559_RS01995 (ABZ559_01995) | terS | 397747..398478 (+) | 732 | WP_043035857.1 | phage terminase small subunit | - |
| ABZ559_RS02000 (ABZ559_02000) | - | 398447..399745 (+) | 1299 | WP_367007110.1 | PBSX family phage terminase large subunit | - |
| ABZ559_RS02005 (ABZ559_02005) | - | 399757..401268 (+) | 1512 | WP_367007112.1 | phage portal protein | - |
| ABZ559_RS02010 (ABZ559_02010) | - | 401273..402895 (+) | 1623 | WP_367007114.1 | phage minor capsid protein | - |
| ABZ559_RS02015 (ABZ559_02015) | - | 402892..403107 (+) | 216 | WP_155778306.1 | hypothetical protein | - |
| ABZ559_RS02020 (ABZ559_02020) | - | 403160..403384 (+) | 225 | WP_367007116.1 | hypothetical protein | - |
| ABZ559_RS02025 (ABZ559_02025) | - | 403545..404123 (+) | 579 | WP_074412922.1 | phage scaffolding protein | - |
| ABZ559_RS02030 (ABZ559_02030) | - | 404152..404976 (+) | 825 | WP_367007117.1 | N4-gp56 family major capsid protein | - |
| ABZ559_RS02035 (ABZ559_02035) | - | 404988..405188 (+) | 201 | WP_043035864.1 | hypothetical protein | - |
| ABZ559_RS02040 (ABZ559_02040) | - | 405195..405392 (+) | 198 | WP_044981541.1 | hypothetical protein | - |
| ABZ559_RS02045 (ABZ559_02045) | - | 405408..405815 (+) | 408 | WP_367007119.1 | hypothetical protein | - |
| ABZ559_RS02050 (ABZ559_02050) | - | 405802..406143 (+) | 342 | WP_367007120.1 | putative minor capsid protein | - |
| ABZ559_RS02055 (ABZ559_02055) | - | 406143..406505 (+) | 363 | WP_043035868.1 | minor capsid protein | - |
| ABZ559_RS02060 (ABZ559_02060) | - | 406502..406903 (+) | 402 | WP_367007122.1 | minor capsid protein | - |
| ABZ559_RS02065 (ABZ559_02065) | - | 406904..407365 (+) | 462 | WP_367007124.1 | phage tail protein | - |
| ABZ559_RS02070 (ABZ559_02070) | - | 407426..407785 (+) | 360 | WP_277846837.1 | hypothetical protein | - |
| ABZ559_RS02075 (ABZ559_02075) | - | 407787..408386 (+) | 600 | WP_043035872.1 | Gp15 family bacteriophage protein | - |
| ABZ559_RS02080 (ABZ559_02080) | - | 408407..411964 (+) | 3558 | WP_367007127.1 | tape measure protein | - |
| ABZ559_RS02085 (ABZ559_02085) | - | 411964..413460 (+) | 1497 | WP_367007129.1 | distal tail protein Dit | - |
| ABZ559_RS02090 (ABZ559_02090) | - | 413464..417474 (+) | 4011 | WP_367007131.1 | phage tail spike protein | - |
| ABZ559_RS02095 (ABZ559_02095) | - | 417486..419546 (+) | 2061 | WP_367007132.1 | DUF859 domain-containing protein | - |
| ABZ559_RS02100 (ABZ559_02100) | - | 419562..420005 (+) | 444 | WP_367007133.1 | DUF1366 domain-containing protein | - |
| ABZ559_RS02105 (ABZ559_02105) | - | 419986..420204 (+) | 219 | WP_044475373.1 | hypothetical protein | - |
| ABZ559_RS02110 (ABZ559_02110) | - | 420208..420486 (+) | 279 | WP_141666873.1 | hypothetical protein | - |
| ABZ559_RS02115 (ABZ559_02115) | - | 420491..420718 (+) | 228 | WP_277846828.1 | phage holin | - |
| ABZ559_RS02120 (ABZ559_02120) | - | 420847..422292 (+) | 1446 | WP_367007134.1 | peptidoglycan amidohydrolase family protein | - |
| ABZ559_RS02125 (ABZ559_02125) | prx | 422463..422657 (+) | 195 | WP_336384255.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 64 a.a. Molecular weight: 7365.25 Da Isoelectric Point: 4.1541
>NTDB_id=1020916 ABZ559_RS02125 WP_336384255.1 422463..422657(+) (prx) [Streptococcus sp. ZY19097]
MLHYDELKQAIDGGYITGDKVNIVRKEGKVFDFVLPDESVRPWEVVTSESVSDILNELRQQEDL
MLHYDELKQAIDGGYITGDKVNIVRKEGKVFDFVLPDESVRPWEVVTSESVSDILNELRQQEDL
Nucleotide
Download Length: 195 bp
>NTDB_id=1020916 ABZ559_RS02125 WP_336384255.1 422463..422657(+) (prx) [Streptococcus sp. ZY19097]
ATGTTACATTATGACGAATTAAAACAGGCGATAGATGGAGGATATATTACAGGCGACAAGGTCAACATTGTCAGAAAAGA
GGGTAAGGTCTTTGATTTTGTTTTACCTGATGAGTCTGTCAGACCTTGGGAGGTAGTAACCTCTGAAAGCGTGTCAGACA
TCTTGAACGAATTAAGACAACAAGAAGACCTCTGA
ATGTTACATTATGACGAATTAAAACAGGCGATAGATGGAGGATATATTACAGGCGACAAGGTCAACATTGTCAGAAAAGA
GGGTAAGGTCTTTGATTTTGTTTTACCTGATGAGTCTGTCAGACCTTGGGAGGTAGTAACCTCTGAAAGCGTGTCAGACA
TCTTGAACGAATTAAGACAACAAGAAGACCTCTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
90.625 |
0.594 |
| prx | Streptococcus pyogenes MGAS8232 |
61.667 |
93.75 |
0.578 |
| prx | Streptococcus pyogenes MGAS315 |
62.069 |
90.625 |
0.563 |
| prx | Streptococcus pyogenes MGAS315 |
58.333 |
93.75 |
0.547 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
65.625 |
0.469 |
| prx | Streptococcus pyogenes MGAS315 |
68.293 |
64.063 |
0.438 |
| prx | Streptococcus pyogenes MGAS315 |
68.293 |
64.063 |
0.438 |