Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   UXQ86_RS10455 Genome accession   NZ_CP157303
Coordinates   2072627..2073097 (-) Length   156 a.a.
NCBI ID   WP_000934765.1    Uniprot ID   -
Organism   Staphylococcus aureus strain BSN83     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2043203..2096506 2072627..2073097 within 0


Gene organization within MGE regions


Location: 2043203..2096506
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  UXQ86_RS10260 (UXQ86_10260) scn 2043203..2043553 (-) 351 WP_000702263.1 complement inhibitor SCIN-A -
  UXQ86_RS10265 (UXQ86_10265) - 2044065..2044400 (-) 336 Protein_1987 SH3 domain-containing protein -
  UXQ86_RS10270 (UXQ86_10270) sak 2045051..2045542 (-) 492 WP_000920038.1 staphylokinase -
  UXQ86_RS10275 (UXQ86_10275) - 2045733..2046488 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  UXQ86_RS10280 (UXQ86_10280) - 2046500..2046754 (-) 255 WP_000611512.1 phage holin -
  UXQ86_RS10285 (UXQ86_10285) - 2046806..2046913 (+) 108 WP_031762631.1 hypothetical protein -
  UXQ86_RS10290 (UXQ86_10290) pepG1 2046966..2047100 (-) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  UXQ86_RS10295 (UXQ86_10295) sea 2047251..2048024 (-) 774 WP_000750412.1 staphylococcal enterotoxin type A -
  UXQ86_RS10300 (UXQ86_10300) - 2048397..2048771 (-) 375 WP_000340977.1 hypothetical protein -
  UXQ86_RS10305 (UXQ86_10305) - 2048827..2049114 (-) 288 WP_001262621.1 hypothetical protein -
  UXQ86_RS10310 (UXQ86_10310) - 2049160..2049312 (-) 153 WP_001000058.1 hypothetical protein -
  UXQ86_RS10315 (UXQ86_10315) - 2049305..2053003 (-) 3699 WP_337274656.1 phage tail spike protein -
  UXQ86_RS10320 (UXQ86_10320) - 2053019..2054509 (-) 1491 WP_001154317.1 phage tail domain-containing protein -
  UXQ86_RS10325 (UXQ86_10325) - 2054509..2059158 (-) 4650 WP_337274657.1 phage tail tape measure protein -
  UXQ86_RS10330 (UXQ86_10330) - 2059214..2059336 (-) 123 WP_000570353.1 hypothetical protein -
  UXQ86_RS10335 (UXQ86_10335) - 2059396..2059842 (-) 447 WP_000442601.1 hypothetical protein -
  UXQ86_RS10340 (UXQ86_10340) - 2059907..2060860 (-) 954 WP_000570652.1 major tail protein -
  UXQ86_RS10345 (UXQ86_10345) - 2060861..2061241 (-) 381 WP_000611454.1 hypothetical protein -
  UXQ86_RS10350 (UXQ86_10350) - 2061238..2061615 (-) 378 WP_000501244.1 HK97-gp10 family putative phage morphogenesis protein -
  UXQ86_RS10355 (UXQ86_10355) - 2061615..2061950 (-) 336 WP_000975314.1 head-tail adaptor protein -
  UXQ86_RS10360 (UXQ86_10360) - 2061937..2062269 (-) 333 WP_001177483.1 head-tail connector protein -
  UXQ86_RS10365 (UXQ86_10365) - 2062278..2062436 (-) 159 WP_001252099.1 hypothetical protein -
  UXQ86_RS10370 (UXQ86_10370) - 2062472..2063719 (-) 1248 WP_000849950.1 phage major capsid protein -
  UXQ86_RS10375 (UXQ86_10375) - 2063807..2064391 (-) 585 WP_000032525.1 HK97 family phage prohead protease -
  UXQ86_RS10380 (UXQ86_10380) - 2064384..2065634 (-) 1251 WP_000511067.1 phage portal protein -
  UXQ86_RS10385 (UXQ86_10385) - 2065640..2065840 (-) 201 WP_000365299.1 hypothetical protein -
  UXQ86_RS10390 (UXQ86_10390) - 2065854..2067548 (-) 1695 WP_000133304.1 phage terminase family protein -
  UXQ86_RS10395 (UXQ86_10395) - 2067551..2068018 (-) 468 WP_000919026.1 phage terminase small subunit P27 family -
  UXQ86_RS10400 (UXQ86_10400) - 2068147..2068491 (-) 345 WP_000817289.1 HNH endonuclease -
  UXQ86_RS10405 (UXQ86_10405) - 2068507..2068959 (-) 453 WP_000406191.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  UXQ86_RS10410 (UXQ86_10410) - 2069074..2069544 (-) 471 WP_000282755.1 hypothetical protein -
  UXQ86_RS10415 (UXQ86_10415) - 2069567..2069767 (-) 201 WP_337274660.1 DUF1514 family protein -
  UXQ86_RS10420 (UXQ86_10420) - 2069767..2070417 (-) 651 WP_001005262.1 hypothetical protein -
  UXQ86_RS10425 (UXQ86_10425) - 2070576..2070725 (-) 150 WP_000595265.1 transcriptional activator RinB -
  UXQ86_RS10430 (UXQ86_10430) - 2070722..2070817 (-) 96 Protein_2020 DUF1381 domain-containing protein -
  UXQ86_RS10435 (UXQ86_10435) - 2070802..2071053 (-) 252 Protein_2021 SA1788 family PVL leukocidin-associated protein -
  UXQ86_RS10440 (UXQ86_10440) - 2071066..2071470 (-) 405 WP_337274658.1 RusA family crossover junction endodeoxyribonuclease -
  UXQ86_RS10445 (UXQ86_10445) - 2071479..2071697 (-) 219 WP_000338527.1 hypothetical protein -
  UXQ86_RS10450 (UXQ86_10450) - 2071704..2072597 (-) 894 WP_000148328.1 DnaD domain-containing protein -
  UXQ86_RS10455 (UXQ86_10455) ssbA 2072627..2073097 (-) 471 WP_000934765.1 single-stranded DNA-binding protein Machinery gene
  UXQ86_RS10460 (UXQ86_10460) - 2073098..2073715 (-) 618 WP_072353921.1 MBL fold metallo-hydrolase -
  UXQ86_RS10465 (UXQ86_10465) - 2073796..2074716 (-) 921 WP_000138475.1 recombinase RecT -
  UXQ86_RS10470 (UXQ86_10470) - 2074718..2076673 (-) 1956 WP_064138715.1 AAA family ATPase -
  UXQ86_RS10475 (UXQ86_10475) - 2076670..2076933 (-) 264 WP_001205732.1 hypothetical protein -
  UXQ86_RS10480 (UXQ86_10480) - 2076942..2077202 (-) 261 WP_000291488.1 DUF1108 family protein -
  UXQ86_RS10485 (UXQ86_10485) - 2077295..2077456 (-) 162 WP_000066020.1 DUF1270 domain-containing protein -
  UXQ86_RS10490 (UXQ86_10490) - 2077453..2077773 (-) 321 WP_001120197.1 DUF771 domain-containing protein -
  UXQ86_RS10495 (UXQ86_10495) - 2077832..2078464 (+) 633 WP_000275058.1 hypothetical protein -
  UXQ86_RS10500 (UXQ86_10500) - 2078479..2078619 (-) 141 WP_000939496.1 hypothetical protein -
  UXQ86_RS10505 (UXQ86_10505) - 2078650..2078847 (-) 198 WP_001148861.1 hypothetical protein -
  UXQ86_RS10510 (UXQ86_10510) - 2078863..2079612 (-) 750 WP_001148337.1 phage antirepressor KilAC domain-containing protein -
  UXQ86_RS10515 (UXQ86_10515) - 2079669..2080208 (+) 540 WP_000351243.1 hypothetical protein -
  UXQ86_RS10520 (UXQ86_10520) - 2080232..2080492 (-) 261 WP_000435341.1 transcriptional regulator -
  UXQ86_RS10525 (UXQ86_10525) - 2080510..2080734 (-) 225 WP_000338186.1 DUF739 family protein -
  UXQ86_RS10530 (UXQ86_10530) - 2080893..2081663 (+) 771 WP_001208482.1 S24 family peptidase -
  UXQ86_RS10535 (UXQ86_10535) seq 2081859..2082587 (+) 729 WP_001033320.1 staphylococcal enterotoxin type Q -
  UXQ86_RS10540 (UXQ86_10540) sek 2082611..2083339 (+) 729 WP_000733771.1 staphylococcal enterotoxin type K -
  UXQ86_RS10545 (UXQ86_10545) - 2083423..2084460 (+) 1038 WP_337274659.1 tyrosine-type recombinase/integrase -
  UXQ86_RS10550 (UXQ86_10550) sph 2084511..2085341 (+) 831 Protein_2044 sphingomyelin phosphodiesterase -
  UXQ86_RS10555 (UXQ86_10555) lukG 2085579..2086595 (-) 1017 WP_000595392.1 bi-component leukocidin LukGH subunit G -
  UXQ86_RS10560 (UXQ86_10560) lukH 2086617..2087672 (-) 1056 WP_000791411.1 bi-component leukocidin LukGH subunit H -
  UXQ86_RS10565 (UXQ86_10565) - 2088108..2089331 (+) 1224 WP_000206625.1 ArgE/DapE family deacylase -
  UXQ86_RS10570 (UXQ86_10570) - 2089658..2090965 (+) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  UXQ86_RS10575 (UXQ86_10575) groL 2091505..2093121 (-) 1617 WP_000240642.1 chaperonin GroEL -
  UXQ86_RS10580 (UXQ86_10580) groES 2093197..2093481 (-) 285 WP_000917289.1 co-chaperone GroES -
  UXQ86_RS10585 (UXQ86_10585) mroQ 2093656..2094399 (+) 744 WP_000197635.1 CPBP family intramembrane glutamic endopeptidase MroQ -
  UXQ86_RS10590 (UXQ86_10590) - 2094424..2095683 (-) 1260 WP_000120297.1 SdrH family protein -
  UXQ86_RS10595 (UXQ86_10595) - 2095880..2096506 (+) 627 WP_000522381.1 nitroreductase family protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17673.54 Da        Isoelectric Point: 4.9627

>NTDB_id=1005650 UXQ86_RS10455 WP_000934765.1 2072627..2073097(-) (ssbA) [Staphylococcus aureus strain BSN83]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTDDNQQDLYQQQAQQTRGQSQYSNNKPVKDNPFANANCPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1005650 UXQ86_RS10455 WP_000934765.1 2072627..2073097(-) (ssbA) [Staphylococcus aureus strain BSN83]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTAAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAGATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATTGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

51.765

100

0.564

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Vibrio cholerae strain A1552

31.492

100

0.365

  ssb Neisseria meningitidis MC58

32.948

100

0.365

  ssb Neisseria gonorrhoeae MS11

32.948

100

0.365

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment