Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4529713..4530527 | Replicon | chromosome |
Accession | NZ_LT615377 | ||
Organism | Escherichia coli isolate 106 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | BV315_RS23950 | Protein ID | WP_001054376.1 |
Coordinates | 4530270..4530527 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | BV315_RS23945 | Protein ID | WP_001309181.1 |
Coordinates | 4529713..4530258 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BV315_RS23920 | 4525404..4526717 | - | 1314 | WP_000460843.1 | galactitol-specific PTS transporter subunit IIC | - |
BV315_RS23925 | 4526729..4527007 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
BV315_RS23930 | 4527004..4528125 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
BV315_RS25505 | 4528370..4528486 | - | 117 | Protein_4265 | VOC family protein | - |
BV315_RS24870 | 4528524..4528742 | - | 219 | Protein_4266 | hypothetical protein | - |
BV315_RS23940 | 4528911..4529657 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
BV315_RS23945 | 4529713..4530258 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
BV315_RS23950 | 4530270..4530527 | - | 258 | WP_001054376.1 | hypothetical protein | Toxin |
BV315_RS25345 | 4530904..4531149 | - | 246 | Protein_4270 | GNAT family N-acetyltransferase | - |
BV315_RS23960 | 4531265..4532505 | + | 1241 | Protein_4271 | helicase YjhR | - |
BV315_RS23970 | 4533088..4534068 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
BV315_RS23975 | 4534133..4535239 | - | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | fimB / fimE / fimA / fimI / fimC | 4529713..4541503 | 11790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T293359 WP_001054376.1 NZ_LT615377:c4530527-4530270 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT293359 WP_001309181.1 NZ_LT615377:c4530258-4529713 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|