Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3443589..3444403 | Replicon | chromosome |
Accession | NZ_LR890410 | ||
Organism | Escherichia coli isolate MSB2_1A-sc-2280429 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | JMW04_RS16350 | Protein ID | WP_001054376.1 |
Coordinates | 3444146..3444403 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | S1NWL7 |
Locus tag | JMW04_RS16345 | Protein ID | WP_001540600.1 |
Coordinates | 3443589..3444134 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW04_RS16315 | 3439280..3440593 | - | 1314 | WP_000460843.1 | galactitol-specific PTS transporter subunit IIC | - |
JMW04_RS16320 | 3440605..3440883 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
JMW04_RS16325 | 3440880..3442001 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
JMW04_RS16330 | 3442246..3442362 | - | 117 | Protein_3186 | VOC family protein | - |
JMW04_RS16335 | 3442400..3442618 | - | 219 | Protein_3187 | hypothetical protein | - |
JMW04_RS16340 | 3442787..3443533 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
JMW04_RS16345 | 3443589..3444134 | - | 546 | WP_001540600.1 | N-acetyltransferase | Antitoxin |
JMW04_RS16350 | 3444146..3444403 | - | 258 | WP_001054376.1 | hypothetical protein | Toxin |
JMW04_RS16355 | 3444780..3445025 | - | 246 | Protein_3191 | GNAT family N-acetyltransferase | - |
JMW04_RS16360 | 3445141..3446381 | + | 1241 | Protein_3192 | DNA helicase | - |
JMW04_RS16365 | 3446964..3447944 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
JMW04_RS16370 | 3448009..3449115 | - | 1107 | WP_001774143.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | fimB / fimE / fimA / fimI / fimC | 3443589..3455379 | 11790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T290924 WP_001054376.1 NZ_LR890410:c3444403-3444146 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19926.87 Da Isoelectric Point: 6.3277
>AT290924 WP_001540600.1 NZ_LR890410:c3444134-3443589 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|