Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3928752..3929566 | Replicon | chromosome |
Accession | NZ_LR134227 | ||
Organism | Escherichia coli strain NCTC9102 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | - |
Locus tag | EL093_RS19100 | Protein ID | WP_126323161.1 |
Coordinates | 3928752..3929009 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | EL093_RS19105 | Protein ID | WP_001309181.1 |
Coordinates | 3929021..3929566 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL093_RS19080 | 3924040..3925146 | + | 1107 | WP_023568191.1 | N-acetylneuraminate epimerase | - |
EL093_RS19085 | 3925211..3926191 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
EL093_RS19090 | 3926774..3928014 | - | 1241 | Protein_3708 | helicase YjhR | - |
EL093_RS19095 | 3928130..3928375 | + | 246 | Protein_3709 | GNAT family N-acetyltransferase | - |
EL093_RS19100 | 3928752..3929009 | + | 258 | WP_126323161.1 | YjhX family toxin | Toxin |
EL093_RS19105 | 3929021..3929566 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
EL093_RS19110 | 3929622..3930368 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
EL093_RS19115 | 3930405..3931247 | + | 843 | Protein_3713 | xylonate dehydratase YjhG | - |
EL093_RS19120 | 3931354..3932703 | + | 1350 | WP_001128363.1 | GntP family permease | - |
EL093_RS19125 | 3933050..3934036 | + | 987 | WP_000373366.1 | sugar-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | fimI / fimA / fimE / fimB | 3918538..3929566 | 11028 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9748.32 Da Isoelectric Point: 11.0090
>T287182 WP_126323161.1 NZ_LR134227:3928752-3929009 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRITSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRITSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT287182 WP_001309181.1 NZ_LR134227:3929021-3929566 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|