Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX(toxin) |
| Location | 4149823..4150637 | Replicon | chromosome |
| Accession | NZ_CP126928 | ||
| Organism | Escherichia coli O2:K1:H4 strain APEC E12053 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | QQA27_RS20350 | Protein ID | WP_001054376.1 |
| Coordinates | 4149823..4150080 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | A0A8E0IVE5 |
| Locus tag | QQA27_RS20355 | Protein ID | WP_001350781.1 |
| Coordinates | 4150092..4150637 (+) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA27_RS20325 (4145111) | 4145111..4146217 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
| QQA27_RS20330 (4146282) | 4146282..4147262 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| QQA27_RS20335 (4147372) | 4147372..4147577 | + | 206 | Protein_3980 | HNH endonuclease | - |
| QQA27_RS20340 (4147845) | 4147845..4149085 | - | 1241 | Protein_3981 | helicase YjhR | - |
| QQA27_RS20345 (4149201) | 4149201..4149332 | + | 132 | WP_001309182.1 | hypothetical protein | - |
| QQA27_RS20350 (4149823) | 4149823..4150080 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
| QQA27_RS20355 (4150092) | 4150092..4150637 | + | 546 | WP_001350781.1 | N-acetyltransferase | Antitoxin |
| QQA27_RS20360 (4150693) | 4150693..4151439 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| QQA27_RS20365 (4151608) | 4151608..4151826 | + | 219 | Protein_3986 | hypothetical protein | - |
| QQA27_RS20370 (4151864) | 4151864..4151980 | + | 117 | Protein_3987 | VOC family protein | - |
| QQA27_RS20375 (4152225) | 4152225..4153082 | + | 858 | Protein_3988 | M42 family peptidase | - |
| QQA27_RS20385 (4154391) | 4154391..4154891 | + | 501 | Protein_3990 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | fimI / fimA / fimE / fimB | 4139608..4150637 | 11029 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T283066 WP_001054376.1 NZ_CP126928:4149823-4150080 [Escherichia coli O2:K1:H4]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19974.91 Da Isoelectric Point: 6.3277
>AT283066 WP_001350781.1 NZ_CP126928:4150092-4150637 [Escherichia coli O2:K1:H4]
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAFIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAFIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|