Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 2863259..2864073 | Replicon | chromosome |
Accession | NZ_CP122316 | ||
Organism | Escherichia coli strain HT-946 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | QCG48_RS14310 | Protein ID | WP_001054376.1 |
Coordinates | 2863816..2864073 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | QCG48_RS14305 | Protein ID | WP_001309181.1 |
Coordinates | 2863259..2863804 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCG48_RS14275 (2858950) | 2858950..2860263 | - | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
QCG48_RS14280 (2860275) | 2860275..2860553 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
QCG48_RS14285 (2860550) | 2860550..2861671 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
QCG48_RS14290 (2861916) | 2861916..2862032 | - | 117 | Protein_2785 | VOC family protein | - |
QCG48_RS14295 (2862070) | 2862070..2862288 | - | 219 | Protein_2786 | hypothetical protein | - |
QCG48_RS14300 (2862457) | 2862457..2863203 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
QCG48_RS14305 (2863259) | 2863259..2863804 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
QCG48_RS14310 (2863816) | 2863816..2864073 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
QCG48_RS14315 (2864564) | 2864564..2864695 | - | 132 | WP_001309182.1 | hypothetical protein | - |
QCG48_RS14320 (2864811) | 2864811..2866051 | + | 1241 | Protein_2791 | helicase YjhR | - |
QCG48_RS14325 (2866319) | 2866319..2866524 | - | 206 | Protein_2792 | HNH endonuclease | - |
QCG48_RS14330 (2866634) | 2866634..2867614 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
QCG48_RS14335 (2867679) | 2867679..2868785 | - | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | fimB / fimE / fimA / fimI / fimC | 2863259..2875049 | 11790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T276675 WP_001054376.1 NZ_CP122316:c2864073-2863816 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT276675 WP_001309181.1 NZ_CP122316:c2863804-2863259 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|