Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 575407..576221 | Replicon | chromosome |
Accession | NZ_CP116115 | ||
Organism | Escherichia coli strain DETEC-P793 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | PIC92_RS02785 | Protein ID | WP_001054376.1 |
Coordinates | 575964..576221 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | S1NWL7 |
Locus tag | PIC92_RS02780 | Protein ID | WP_001540600.1 |
Coordinates | 575407..575952 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC92_RS02750 (571098) | 571098..572411 | - | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
PIC92_RS02755 (572423) | 572423..572701 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
PIC92_RS02760 (572698) | 572698..573819 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
PIC92_RS02765 (574064) | 574064..574180 | - | 117 | Protein_535 | VOC family protein | - |
PIC92_RS02770 (574218) | 574218..574436 | - | 219 | Protein_536 | hypothetical protein | - |
PIC92_RS02775 (574605) | 574605..575351 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
PIC92_RS02780 (575407) | 575407..575952 | - | 546 | WP_001540600.1 | N-acetyltransferase | Antitoxin |
PIC92_RS02785 (575964) | 575964..576221 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
PIC92_RS02790 (576712) | 576712..576843 | - | 132 | WP_001309182.1 | hypothetical protein | - |
PIC92_RS02795 (576959) | 576959..578199 | + | 1241 | Protein_541 | helicase YjhR | - |
PIC92_RS02800 (578467) | 578467..578672 | - | 206 | Protein_542 | HNH endonuclease | - |
PIC92_RS02805 (578782) | 578782..579762 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
PIC92_RS02810 (579827) | 579827..580933 | - | 1107 | WP_001774143.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | fimB / fimE / fimA / fimI / fimC | 575407..587197 | 11790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T268054 WP_001054376.1 NZ_CP116115:c576221-575964 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19926.87 Da Isoelectric Point: 6.3277
>AT268054 WP_001540600.1 NZ_CP116115:c575952-575407 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|