Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3468430..3469244 | Replicon | chromosome |
Accession | NZ_CP110996 | ||
Organism | Escherichia coli strain XYEH3783 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | ORI30_RS16725 | Protein ID | WP_001054376.1 |
Coordinates | 3468987..3469244 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | S1NWL7 |
Locus tag | ORI30_RS16720 | Protein ID | WP_001540600.1 |
Coordinates | 3468430..3468975 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI30_RS16690 (3464121) | 3464121..3465434 | - | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
ORI30_RS16695 (3465446) | 3465446..3465724 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
ORI30_RS16700 (3465721) | 3465721..3466842 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
ORI30_RS16705 (3467087) | 3467087..3467203 | - | 117 | Protein_3260 | VOC family protein | - |
ORI30_RS16710 (3467241) | 3467241..3467459 | - | 219 | Protein_3261 | hypothetical protein | - |
ORI30_RS16715 (3467628) | 3467628..3468374 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
ORI30_RS16720 (3468430) | 3468430..3468975 | - | 546 | WP_001540600.1 | N-acetyltransferase | Antitoxin |
ORI30_RS16725 (3468987) | 3468987..3469244 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
ORI30_RS16730 (3469735) | 3469735..3469866 | - | 132 | WP_001309182.1 | hypothetical protein | - |
ORI30_RS16735 (3469982) | 3469982..3471222 | + | 1241 | Protein_3266 | helicase YjhR | - |
ORI30_RS16740 (3471490) | 3471490..3471695 | - | 206 | Protein_3267 | HNH endonuclease | - |
ORI30_RS16745 (3471805) | 3471805..3472785 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
ORI30_RS16750 (3472850) | 3472850..3473956 | - | 1107 | WP_001774143.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | fimB / fimE / fimA / fimI / fimC | 3468430..3480220 | 11790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T264699 WP_001054376.1 NZ_CP110996:c3469244-3468987 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19926.87 Da Isoelectric Point: 6.3277
>AT264699 WP_001540600.1 NZ_CP110996:c3468975-3468430 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|