Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 2914438..2915252 | Replicon | chromosome |
| Accession | NZ_CP102488 | ||
| Organism | Escherichia coli O15:H18 strain ST69 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | NUI00_RS14165 | Protein ID | WP_001054376.1 |
| Coordinates | 2914438..2914695 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | U9Z4B8 |
| Locus tag | NUI00_RS14170 | Protein ID | WP_001309181.1 |
| Coordinates | 2914707..2915252 (+) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUI00_RS14140 (2909726) | 2909726..2910832 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
| NUI00_RS14145 (2910897) | 2910897..2911877 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| NUI00_RS14150 (2911987) | 2911987..2912192 | + | 206 | Protein_2770 | HNH endonuclease | - |
| NUI00_RS14155 (2912460) | 2912460..2913700 | - | 1241 | Protein_2771 | helicase YjhR | - |
| NUI00_RS14160 (2913816) | 2913816..2913947 | + | 132 | WP_001309182.1 | hypothetical protein | - |
| NUI00_RS14165 (2914438) | 2914438..2914695 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
| NUI00_RS14170 (2914707) | 2914707..2915252 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
| NUI00_RS14175 (2915308) | 2915308..2916054 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| NUI00_RS14180 (2916223) | 2916223..2916441 | + | 219 | Protein_2776 | hypothetical protein | - |
| NUI00_RS14185 (2916479) | 2916479..2916595 | + | 117 | Protein_2777 | VOC family protein | - |
| NUI00_RS14190 (2916840) | 2916840..2917961 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
| NUI00_RS14195 (2917958) | 2917958..2918236 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
| NUI00_RS14200 (2918248) | 2918248..2919561 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | fimI / fimA / fimE / fimB | 2904224..2915252 | 11028 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T253748 WP_001054376.1 NZ_CP102488:2914438-2914695 [Escherichia coli O15:H18]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT253748 WP_001309181.1 NZ_CP102488:2914707-2915252 [Escherichia coli O15:H18]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|