Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 4409021..4409835 | Replicon | chromosome |
| Accession | NZ_CP102379 | ||
| Organism | Escherichia coli strain BM28 lysU | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | NR350_RS21380 | Protein ID | WP_001054376.1 |
| Coordinates | 4409578..4409835 (-) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | U9Z4B8 |
| Locus tag | NR350_RS21375 | Protein ID | WP_001309181.1 |
| Coordinates | 4409021..4409566 (-) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR350_RS21345 (4404712) | 4404712..4406025 | - | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
| NR350_RS21350 (4406037) | 4406037..4406315 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
| NR350_RS21355 (4406312) | 4406312..4407433 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
| NR350_RS21360 (4407678) | 4407678..4407794 | - | 117 | Protein_4153 | VOC family protein | - |
| NR350_RS21365 (4407832) | 4407832..4408050 | - | 219 | Protein_4154 | hypothetical protein | - |
| NR350_RS21370 (4408219) | 4408219..4408965 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| NR350_RS21375 (4409021) | 4409021..4409566 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
| NR350_RS21380 (4409578) | 4409578..4409835 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
| NR350_RS21385 (4410326) | 4410326..4410457 | - | 132 | WP_001309182.1 | hypothetical protein | - |
| NR350_RS21390 (4410573) | 4410573..4411813 | + | 1241 | Protein_4159 | helicase YjhR | - |
| NR350_RS21395 (4412081) | 4412081..4412286 | - | 206 | Protein_4160 | HNH endonuclease | - |
| NR350_RS21400 (4412396) | 4412396..4413376 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| NR350_RS21405 (4413441) | 4413441..4414547 | - | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | fimB / fimE / fimA / fimI / fimC | 4409021..4422150 | 13129 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T253557 WP_001054376.1 NZ_CP102379:c4409835-4409578 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT253557 WP_001309181.1 NZ_CP102379:c4409566-4409021 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|