Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4543875..4544689 | Replicon | chromosome |
Accession | NZ_CP102378 | ||
Organism | Escherichia coli strain JB41 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | NR351_RS22095 | Protein ID | WP_001054376.1 |
Coordinates | 4544432..4544689 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | NR351_RS22090 | Protein ID | WP_001309181.1 |
Coordinates | 4543875..4544420 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR351_RS22060 (4539566) | 4539566..4540879 | - | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
NR351_RS22065 (4540891) | 4540891..4541169 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
NR351_RS22070 (4541166) | 4541166..4542287 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
NR351_RS22075 (4542532) | 4542532..4542648 | - | 117 | Protein_4295 | VOC family protein | - |
NR351_RS22080 (4542686) | 4542686..4542904 | - | 219 | Protein_4296 | hypothetical protein | - |
NR351_RS22085 (4543073) | 4543073..4543819 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
NR351_RS22090 (4543875) | 4543875..4544420 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
NR351_RS22095 (4544432) | 4544432..4544689 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
NR351_RS22100 (4545180) | 4545180..4545311 | - | 132 | WP_001309182.1 | hypothetical protein | - |
NR351_RS22105 (4545427) | 4545427..4546667 | + | 1241 | Protein_4301 | helicase YjhR | - |
NR351_RS22110 (4546935) | 4546935..4547140 | - | 206 | Protein_4302 | HNH endonuclease | - |
NR351_RS22115 (4547250) | 4547250..4548230 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
NR351_RS22120 (4548295) | 4548295..4549401 | - | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | fimB / fimE / fimA / fimI / fimC | 4543875..4555665 | 11790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T253523 WP_001054376.1 NZ_CP102378:c4544689-4544432 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT253523 WP_001309181.1 NZ_CP102378:c4544420-4543875 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|